Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-Rv0077c

Mycobacterium tuberculosis, Mycobacterium bovis hypothetical protein, Rv0077c MB0079C probable oxidoreductase

Comment
Probable oxidoreductase. O53622 AE006920_7 gene MT0083 Mycobacterium tuberculosis CDC1551 . Mycobacterium bovis Q7U2W6 MB0079C. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: myctu-Rv0077c
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLAGRGLR
CIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTG
GVVTQLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAA
IQVMRAPAARNRAYAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSL
RTEVTTAVAARLPEFDKPALIAWSADDVFFALENGQRLAATIPRARFEVI
EGARTFSMVDSPDRLADQLSTVAVRT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLAGRGLR
CIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTG
GVVTQLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAA
IQVMRAPAARNRAYAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSL
RTEVTTAVAARLPEFDKPALIAWSADDVFFALENGQRLAATIPRARFEVI
EGARTFSMVDSPDRLADQLSTVAVRT


References
3 more
    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer