myctu-Rv0217c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Probable lipase lipW Rv0217c

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : Z92669, BX248334, AE000516
3 UniProt : Q7DA92, P96399, A5TYU2
1 Ncbi-nid : 3242271
1 Ncbi-pid : 1871590
3 UniProtTrembl : Q7DA92, P96399, A5TYU2
3 Interpro : Q7DA92, P96399, A5TYU2
3 Prodom : Q7DA92, P96399, A5TYU2
3 Pfam : Q7DA92, P96399, A5TYU2
3 PIRSF : Q7DA92, P96399, A5TYU2
3 SUPERFAM : Q7DA92, P96399, A5TYU2
3 QuickSwissBlast : Q7DA92, P96399, A5TYU2
 
Sequence
Graphical view for this peptide sequence: myctu-Rv0217c
Colored MSA for Hormone-sensitive_lipase_like (raw)
VSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTPPDIEV
LTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSR
LGITVASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASA
GGGLAAALALLARDRGGITPAFQLLVYPMLDDRPSIAPANPHYRLWNGRA
NRFGWRAYLGDADARVAVPGRRDDLGGLAPAWIGVGTHDLLHDEDLAYAE
RLTAAGVPCQVEVVEGAFHGFDRVAPNVGVSQRFFTSQCNSLRAALALSN
RT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTPPDIEV
LTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSR
LGITVASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASA
GGGLAAALALLARDRGGITPAFQLLVYPMLDDRPSIAPANPHYRLWNGRA
NRFGWRAYLGDADARVAVPGRRDDLGGLAPAWIGVGTHDLLHDEDLAYAE
RLTAAGVPCQVEVVEGAFHGFDRVAPNVGVSQRFFTSQCNSLRAALALSN
RT

no DNA




References
5 more
    Title: Structural Basis for the Strict Substrate Selectivity of the Mycobacterial Hydrolase LipW
    McKary MG, Abendroth J, Edwards TE, Johnson RJ
    Ref: Biochemistry, 55:7099, 2016 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer