Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-Rv0220

Mycobacterium tuberculosis, Mycobacterium bovis, Esterase lipC Rv0220

Comment
Rv0220 gene lipC MTCY8D5.15 Orf 15 of MTCY8D5, old myctu-este2. Esterase that can hydrolyze short-chain esters with the carbon chain containing 2 to 10 carbon atoms. Does not have lipase activity. Is highly immunogenic and elicits strong humoral immune responses in both HIV-negative (HIV-) and HIV-positive (HIV+) tuberculosis (TB) patients. Also elicits pro-inflammatory cytokine and chemokine responses from macrophages and pulmonary epithelial cells. May participate in the progression of active tuberculosis both by contributing to the utilization of lipid substrates for bacterial growth and replication, and by modulating immune responses There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: Z92669, DS016978, CP000611
2 UniProt : P96402, A5TYU5
1 Ncbi-nid : 3242271
1 Ncbi-pid : 1871593
2 UniProt : P96402, A5TYU5
2 Interpro : P96402, A5TYU5
2 Pfam : P96402, A5TYU5
2 PIRSF : P96402, A5TYU5
2 SUPERFAM : P96402, A5TYU5
Sequence
Graphical view for this peptide sequence: myctu-Rv0220
Colored MSA for BD-FAE (raw)
MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLKPLGGV
TAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIV
SPDDLAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKD
MPTKPAPVLIFVPGGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPH
HRWPRHILDVKTAIAWARANVDKFGGDRNFIAVAGCSAGGHLSALAGLTA
NDPQYQAELPEGSDTSVDAVVGIYGRYDWEDRSTPERARFVDFLERVVVQ
RTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVEQARSFVERLR
AVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFAK
EVI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLKPLGGV
TAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIV
SPDDLAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKD
MPTKPAPVLIFVPGGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPH
HRWPRHILDVKTAIAWARANVDKFGGDRNFIAVAGCSAGGHLSALAGLTA
NDPQYQAELPEGSDTSVDAVVGIYGRYDWEDRSTPERARFVDFLERVVVQ
RTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVEQARSFVERLR
AVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFAK
EVI


References
5 more
    Title: LipC (Rv0220) is an immunogenic cell surface esterase of Mycobacterium tuberculosis
    Shen G, Singh K, Chandra D, Serveau-Avesque C, Maurin D, Canaan S, Singla R, Behera D, Laal S
    Ref: Infect Immun, 80:243, 2012 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: An integrated map of the genome of the tubercle bacillus, Mycobacterium tuberculosis H37Rv, and comparison with Mycobacterium leprae
    Philipp WJ, Poulet S, Eiglmeier K, Pascopella L, Balasubramanian V, Heym B, Bergh S, Bloom BR, Jacobs WR, Jr., Cole ST
    Ref: Proc Natl Acad Sci U S A, 93:3132, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer