myctu-Rv1076

 
Mycobacterium tuberculosis Mycobacterium bovis Probable lipase lipU Rv1076

Comment
(from Uniprot) Esterase that shows preference for short chain fatty acids. Contributes to the growth of M.tuberculosis during the nutritive stress. Elicits strong humoral response in both extrapulmonary and relapsed cases of tuberculosis patientsThere are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AL021897, BX248337, AE000516
3 UniProt : O53424, Q7D8W1, A5U1C2
1 Ncbi-nid : 3256022
1 Ncbi-pid : 2896713
3 UniProtTrembl : O53424, Q7D8W1, A5U1C2
3 Interpro : O53424, Q7D8W1, A5U1C2
3 Prodom : O53424, Q7D8W1, A5U1C2
3 Pfam : O53424, Q7D8W1, A5U1C2
3 PIRSF : O53424, Q7D8W1, A5U1C2
3 SUPERFAM : O53424, Q7D8W1, A5U1C2
3 QuickSwissBlast : O53424, Q7D8W1, A5U1C2
 
Sequence
Graphical view for this peptide sequence: myctu-Rv1076
Colored MSA for Hormone-sensitive_lipase_like (raw)
MAVRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQL
VRASGVLPADGTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVV
DYRLIPKHSIGMALDDCHDGYRWLRLLGYEPEQIVLAGDSAGGYLALALA
QRLQEVGEEPAALVAISPLLQLAKEHKQAHPNIKTDAMFPARAFDALDAL
VASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEVLLHDAQLAAA
KLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQL
VRASGVLPADGTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVV
DYRLIPKHSIGMALDDCHDGYRWLRLLGYEPEQIVLAGDSAGGYLALALA
QRLQEVGEEPAALVAISPLLQLAKEHKQAHPNIKTDAMFPARAFDALDAL
VASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEVLLHDAQLAAA
KLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG

no DNA




References
6 more
    Title: Characterization of an extracellular protein, Rv1076 from M. tuberculosis with a potential role in humoral response
    Kaur G, Saini V, Kumari B, Kaur J
    Ref: Int J Biol Macromol, 101:621, 2017 : PubMed

            

    Title: Characterization and function of Mycobacterium tuberculosis H37Rv Lipase Rv1076 (LipU)
    Li C, Li Q, Zhang Y, Gong Z, Ren S, Li P, Xie J
    Ref: Microbiol Res, 196:7, 2017 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer