myctu-Rv1184c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv1184c MT1221 Hypothetical exported protein

Comment
Other strains: Mycobacterium tuberculosis Rv1184c MT1221 (and strains C; Haarlem; F11; ATCC25177/H37Ra; EAS054; T46; SUMu009; SUMu006; KZN 1435 / MDR; SUMu002; 94_M4241A; SUMu007; SUMu008; CDC1551A; 02_1987; SUMu011; T92; GM 1503; SUMu003; T85; W-148; SUMu001; K85; KZN 4207; SUMu005; SUMu010; SUMu012; SUMu004; T17) Mycobacterium bovis (and strains BCG/Tokyo172/ATCC35737/TMC 1019; BCG/Pasteur1173P2). There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family PE-PPE
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 6 more: CH482373, BX248338, AP010918
3 UniProt : Q7D8P0, A5U1N2, O50440
3 UniProtTrembl : Q7D8P0, A5U1N2, O50440
3 Interpro : Q7D8P0, A5U1N2, O50440
3 Prodom : Q7D8P0, A5U1N2, O50440
3 Pfam : Q7D8P0, A5U1N2, O50440
3 PIRSF : Q7D8P0, A5U1N2, O50440
3 SUPERFAM : Q7D8P0, A5U1N2, O50440
3 QuickSwissBlast : Q7D8P0, A5U1N2, O50440
 
Sequence
Graphical view for this peptide sequence: myctu-Rv1184c
Colored MSA for PE-PPE (raw)
MKRVIAGAFAVWLVGWAGGFGTAIAASEPAYPWAPGPPPSPSPVGDASTA
KVVYALGGARMPGIPWYEYTNQAGSQYFPNAKHDLIDYPAGAAFSWWPTM
LLPPGSHQDNMTVGVAVKDGTNSLDNAIHHGTDPAAAVGLSQGSLVLDQE
QARLANDPTAPAPDKLQFTTFGDPTGRHAFGASFLARIFPPGSHIPIPFI
EYTMPQQVDSQYDTNHVVTAYDGFSDFPDRPDNLLAVANAAIGAAIAHTP
IGFTGPGDVPPQNIRTTVNSRGATTTTYLVPVNHLPLTLPLRYLGMSDAE
VDQIDSVLQPQIDAAYARNDNWFTRPVSVDPVRGLDPLTAPGSIVEGARG
LLGSPAFGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRVIAGAFAVWLVGWAGGFGTAIAASEPAYPWAPGPPPSPSPVGDASTA
KVVYALGGARMPGIPWYEYTNQAGSQYFPNAKHDLIDYPAGAAFSWWPTM
LLPPGSHQDNMTVGVAVKDGTNSLDNAIHHGTDPAAAVGLSQGSLVLDQE
QARLANDPTAPAPDKLQFTTFGDPTGRHAFGASFLARIFPPGSHIPIPFI
EYTMPQQVDSQYDTNHVVTAYDGFSDFPDRPDNLLAVANAAIGAAIAHTP
IGFTGPGDVPPQNIRTTVNSRGATTTTYLVPVNHLPLTLPLRYLGMSDAE
VDQIDSVLQPQIDAAYARNDNWFTRPVSVDPVRGLDPLTAPGSIVEGARG
LLGSPAFGG

no DNA




References
5 more
    Title: The rv1184c Locus Encodes Chp2, an Acyltransferase in Mycobacterium tuberculosis Polyacyltrehalose Lipid Biosynthesis
    Touchette MH, Holsclaw CM, Previti ML, Solomon VC, Leary JA, Bertozzi CR, Seeliger JC
    Ref: Journal of Bacteriology, 197:201, 2015 : PubMed

            

    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer