myctu-Rv1399c

 
Mycobacterium tuberculosis and Mycobacterium bovis. Carboxylesterase lipH Rv1399c NLHH

Comment
myctu-Rv1399 is a nonlipolytic hydrolase (Canaan et al. 2004). Hydrolyzes various short-chain esters, such as triacylglycerols and vinyl esters. Has no activity against emulsified substrates.. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: myctu-Rv1399c
No structure
No kinetic



>3 Genbank links 3 more: Z80108, BX248338, AE000516
3 UniProt : P9WK87, P9WK86, A5U2A1
1 Ncbi-nid : 325601
1 Ncbi-pid : 1542907
1 UniProtTrembl : A5U2A1
1 Interpro : A5U2A1
1 Prodom : A5U2A1
1 Pfam : A5U2A1
1 PIRSF : A5U2A1
1 SUPERFAM : A5U2A1
1 QuickSwissBlast : A5U2A1
 
Sequence
Graphical view for this peptide sequence: myctu-Rv1399c
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTEPTVARPDIDPVLKMLLDTFPVTFTAADGVEVARARLRQLKTPPELLP
ELRIEERTVGYDGLTDIPVRVYWPPVVRDNLPVVVYYHGGGWSLGGLDTH
DPVARAHAVGAQAIVVSVDYRLAPEHPYPAGIDDSWAALRWVGENAAELG
GDPSRIAVAGDSAGGNISAVMAQLARDVGGPPLVFQLLWYPTTMADLSLP
SFTENADAPILDRDVIDAFLAWYVPGLDISDHTMLPTTLAPGNADLSGLP
PAFIGTAEHDPLRDDGACYAELLTAAGVSVELSNEPTMVHGYVNFALVVP
AAAEATGRGLAALKRALHA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTEPTVARPDIDPVLKMLLDTFPVTFTAADGVEVARARLRQLKTPPELLP
ELRIEERTVGYDGLTDIPVRVYWPPVVRDNLPVVVYYHGGGWSLGGLDTH
DPVARAHAVGAQAIVVSVDYRLAPEHPYPAGIDDSWAALRWVGENAAELG
GDPSRIAVAGDSAGGNISAVMAQLARDVGGPPLVFQLLWYPTTMADLSLP
SFTENADAPILDRDVIDAFLAWYVPGLDISDHTMLPTTLAPGNADLSGLP
PAFIGTAEHDPLRDDGACYAELLTAAGVSVELSNEPTMVHGYVNFALVVP
AAAEATGRGLAALKRALHA

Graphical view for this nucleotide DNA sequence (1159 bp): myctu-Rv1399c



References
6 more
    Title: Small-Molecule Probes Reveal Esterases with Persistent Activity in Dormant and Reactivating Mycobacterium tuberculosis
    Tallman KR, Levine SR, Beatty KE
    Ref: ACS Infect Dis, 2:936, 2016 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: An integrated map of the genome of the tubercle bacillus, Mycobacterium tuberculosis H37Rv, and comparison with Mycobacterium leprae
    Philipp WJ, Poulet S, Eiglmeier K, Pascopella L, Balasubramanian V, Heym B, Bergh S, Bloom BR, Jacobs WR, Jr., Cole ST
    Ref: Proc Natl Acad Sci U S A, 93:3132, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer