myctu-Rv1430

 
Mycobacterium tuberculosis, Mycobacterium bovis, MT1474, Rv1430 PE family protein PE16

Comment
Esterase that hydrolyzes short to medium chain fatty acid esters with the highest specific activity for p-nitrophenyl caproate (pNPC6). Has lower activity with p-nitrophenyl caprylate (pNPC8) and p-nitrophenyl butyrate (pNPC4). Has weak activity with p-nitrophenyl caprate (pNPC10) and p-nitrophenyl laurate (pNPC12). Does not possess lipolytic activity and cutinase activity. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family PE-PPE
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Paranitrophenyl-hexanoate ,
Inhibitor: PMSF ,
>3 Genbank links 17 more: AL123456, WP_003407378, YP_177810
3 UniProt : L7N697, A5U2D2, Q7D8G5
>3 UniProtTrembl links 1 more: L7N697, I6XBG6, A5U2D2
>3 Interpro links 1 more: L7N697, I6XBG6, A5U2D2
>3 Prodom links 1 more: L7N697, I6XBG6, A5U2D2
>3 Pfam links 1 more: L7N697, I6XBG6, A5U2D2
>3 PIRSF links 1 more: L7N697, I6XBG6, A5U2D2
>3 SUPERFAM links 1 more: L7N697, I6XBG6, A5U2D2
>3 QuickSwissBlast links 1 more: L7N697, I6XBG6, A5U2D2
 
Sequence
Graphical view for this peptide sequence: myctu-Rv1430
Colored MSA for PE-PPE (raw)
MSFVFAVPEMVAATASDLASLGAALSEATAAAAIPTTQVLAAAADEVSAA
IAELFGAHGQEFQALSAQASAFHDRFVRALSAAAGWYVDAEAANAALVDT
AATGASELGSGGRTALILGSTGTPRPPFDYMQQVYDRYIAPHYLGYAFSG
LYTPAQFQPWTGIPSLTYDQSVAEGAGYLHTAIMQQVAAGNDVVVLGFSQ
GASVATLEMRHLASLPAGVAPSPDQLSFVLLGNPNNPNGGILARFPGLYL
QSLGLTFNGATPDTDYATTIYTTQYDGFADFPKYPLNILADVNALLGIYY
SHSLYYGLTPEQVASGIVLPVSSPDTNTTYILLPNEDLPLLQPLRGIVPE
PLLDLIEPDLRAIIELGYDRTGYADVPTPAALFPVHIDPIAVPPQIGAAI
GGPLTALDGLLDTVINDQLNPVVTSGIYQAGAELSVAAAGYGAPAGVTNA
IFIGQQVLPILVEGPGALVTADTHYLVDAIQDLAAGDLSGFNQNLQLIPA
TNIALLVFAAGIPAVAAVAILTGQDFPV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSFVFAVPEMVAATASDLASLGAALSEATAAAAIPTTQVLAAAADEVSAA
IAELFGAHGQEFQALSAQASAFHDRFVRALSAAAGWYVDAEAANAALVDT
AATGASELGSGGRTALILGSTGTPRPPFDYMQQVYDRYIAPHYLGYAFSG
LYTPAQFQPWTGIPSLTYDQSVAEGAGYLHTAIMQQVAAGNDVVVLGFSQ
GASVATLEMRHLASLPAGVAPSPDQLSFVLLGNPNNPNGGILARFPGLYL
QSLGLTFNGATPDTDYATTIYTTQYDGFADFPKYPLNILADVNALLGIYY
SHSLYYGLTPEQVASGIVLPVSSPDTNTTYILLPNEDLPLLQPLRGIVPE
PLLDLIEPDLRAIIELGYDRTGYADVPTPAALFPVHIDPIAVPPQIGAAI
GGPLTALDGLLDTVINDQLNPVVTSGIYQAGAELSVAAAGYGAPAGVTNA
IFIGQQVLPILVEGPGALVTADTHYLVDAIQDLAAGDLSGFNQNLQLIPA
TNIALLVFAAGIPAVAAVAILTGQDFPV

no DNA




References
4 more
    Title: The PE16 (Rv1430) of Mycobacterium tuberculosis Is an Esterase Belonging to Serine Hydrolase Superfamily of Proteins
    Sultana R, Vemula MH, Banerjee S, Guruprasad L
    Ref: PLoS ONE, 8:e55320, 2013 : PubMed

            

    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer