myctu-Rv2045c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium paratuberculosis, Mycobacterium africanum, Mycobacterium canettii, Mycobacterium caprae Probable carboxylesterase lip T Rv2045c

Comment
Rv2045c gene lipT MTV018.32c Orf 32c of MTV018. Identical to AE007060 MT2105 from Mycobacterium tuberculosis CDC1551. Trembl Q7VES4 is for Mycobacterium bovis MB2071C BX248341 Mycobacterium tuberculosis CDC1551 Q7D7J9 . There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block C
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 112 more: AL021899, AE007060, BX248341
>3 UniProt links 4 more: A5U470, G0TM39, R4M766
1 Ncbi-nid : 2896750
1 Ncbi-pid : 2896782
>3 UniProtTrembl links 11 more: O53488, Q7D7J9, A5U470
>3 Interpro links 11 more: O53488, Q7D7J9, A5U470
>3 Prodom links 11 more: O53488, Q7D7J9, A5U470
>3 Pfam links 11 more: O53488, Q7D7J9, A5U470
>3 PIRSF links 11 more: O53488, Q7D7J9, A5U470
>3 SUPERFAM links 11 more: O53488, Q7D7J9, A5U470
>3 QuickSwissBlast links 11 more: O53488, Q7D7J9, A5U470
 
Sequence
Graphical view for this peptide sequence: myctu-Rv2045c
Colored MSA for Carb_B_Bacteria (raw)
MALESATVGSMHERTVRARTATGIVEGFTRDGVHRWRSIPYARAPVGSLR
FRAPQPAQPWPGVRHCHTFANCAPQQRRYTVMGIGRYQTRSEDCLTLNVV
TPEEPATQPLPVMVFIHGGGYILGSSATPIYDGAALARRGCVYVSVNYRL
GALGCLDLSSLSTPQITLDSNVYLRDLVLALRWVHDNIAEFGGDPGNVTI
FGESAGAHITATLLAVPAAKGLFARAISESPAAGMVRSREVAAEFAARFA
NLIGARTQDAANALMQASPAQLVEAQHHLIRQGMRKRLGAFPIGPVFGDD
YLPMDPVEAMRSGRVHAVPLIVGTNAEEGRLFTRFLGMLPTNEPMVEELL
SGMKPADRERITAAYPNYPAPSACIQLGGDFAFSSAAWQIAEAHGANAPT
YLYRYDYAPRTLRWSGFGATHATELFAVFDIYRTRFGALLTAAADRRAAL
RVSNEVQRRWRCFSQIGVPGDDWPAYTQDDRAVLVFDRRCRIEFDPHQHR
RIAWDGFSLAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALESATVGSMHERTVRARTATGIVEGFTRDGVHRWRSIPYARAPVGSLR
FRAPQPAQPWPGVRHCHTFANCAPQQRRYTVMGIGRYQTRSEDCLTLNVV
TPEEPATQPLPVMVFIHGGGYILGSSATPIYDGAALARRGCVYVSVNYRL
GALGCLDLSSLSTPQITLDSNVYLRDLVLALRWVHDNIAEFGGDPGNVTI
FGESAGAHITATLLAVPAAKGLFARAISESPAAGMVRSREVAAEFAARFA
NLIGARTQDAANALMQASPAQLVEAQHHLIRQGMRKRLGAFPIGPVFGDD
YLPMDPVEAMRSGRVHAVPLIVGTNAEEGRLFTRFLGMLPTNEPMVEELL
SGMKPADRERITAAYPNYPAPSACIQLGGDFAFSSAAWQIAEAHGANAPT
YLYRYDYAPRTLRWSGFGATHATELFAVFDIYRTRFGALLTAAADRRAAL
RVSNEVQRRWRCFSQIGVPGDDWPAYTQDDRAVLVFDRRCRIEFDPHQHR
RIAWDGFSLAN

no DNA




References
15 more
    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: An integrated map of the genome of the tubercle bacillus, Mycobacterium tuberculosis H37Rv, and comparison with Mycobacterium leprae
    Philipp WJ, Poulet S, Eiglmeier K, Pascopella L, Balasubramanian V, Heym B, Bergh S, Bloom BR, Jacobs WR, Jr., Cole ST
    Ref: Proc Natl Acad Sci U S A, 93:3132, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer