myctu-Rv3487c

 
Mycobacterium tuberculosis, Mycobacterium bovis Rv3487c Carboxylesterase/phospholipase lipF

Comment
(from Uniprot) Hydrolyzes short-chain esters. Shows maximal activity with triacetin and p-nitrophenyl acetate. Has no enzyme activity on triacylglycerides or p-nitrophenyl esters (p-NP) with long fatty acids (tricaprin, p-NP caprylate, or p-NP caprate); experiments performed with enzyme missing the first 97 residues (PubMed:15939293). Has phospholipase C activity, making 1,2-DAG phosphocholine; experiments performed with enzyme missing the first 97 residues. There are more than 3000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : Z95390, BX248346, AE000516
3 UniProt : Q7D5F9, O06350, A5U8G2
1 Ncbi-nid : 3261766
1 Ncbi-pid : 2104410
3 UniProtTrembl : Q7D5F9, O06350, A5U8G2
3 Interpro : Q7D5F9, O06350, A5U8G2
3 Prodom : Q7D5F9, O06350, A5U8G2
3 Pfam : Q7D5F9, O06350, A5U8G2
3 PIRSF : Q7D5F9, O06350, A5U8G2
3 SUPERFAM : Q7D5F9, O06350, A5U8G2
3 QuickSwissBlast : Q7D5F9, O06350, A5U8G2
 
Sequence
Graphical view for this peptide sequence: myctu-Rv3487c
Colored MSA for Hormone-sensitive_lipase_like (raw)
VRAPGVRAADGAGRVVLYLHGGAFVMCGPNSHSRIVNALSGFAESPVLIV
DYRLIPKHSLGMALDDCHDAYQWLRARGYRPEQIVLAGDSAGGYLALALA
QRLQCDDEKPAAIVAISPLLQLAKGPKQDHPNIGTDAMFPARAFDALAAW
VRAAAAKNMVDGRPEDLYEPLDHIESSLPPTLIHVSGSEVLLHDAQLGAG
KLAAAGVCAEVRVWPGQAHLFQLATPLVPEATRSLRQIGQFIRDATADSS
LSPVHRSRYVAGSPRAASRGAFGQSPI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VRAPGVRAADGAGRVVLYLHGGAFVMCGPNSHSRIVNALSGFAESPVLIV
DYRLIPKHSLGMALDDCHDAYQWLRARGYRPEQIVLAGDSAGGYLALALA
QRLQCDDEKPAAIVAISPLLQLAKGPKQDHPNIGTDAMFPARAFDALAAW
VRAAAAKNMVDGRPEDLYEPLDHIESSLPPTLIHVSGSEVLLHDAQLGAG
KLAAAGVCAEVRVWPGQAHLFQLATPLVPEATRSLRQIGQFIRDATADSS
LSPVHRSRYVAGSPRAASRGAFGQSPI

Graphical view for this nucleotide DNA sequence (953 bp): myctu-Rv3487c



References
6 more
    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: An integrated map of the genome of the tubercle bacillus, Mycobacterium tuberculosis H37Rv, and comparison with Mycobacterium leprae
    Philipp WJ, Poulet S, Eiglmeier K, Pascopella L, Balasubramanian V, Heym B, Bergh S, Bloom BR, Jacobs WR, Jr., Cole ST
    Ref: Proc Natl Acad Sci U S A, 93:3132, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer