myctu-Rv3591c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv3591c Putative uncharacterized protein

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



 
Sequence
Graphical view for this peptide sequence: myctu-Rv3591c
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPRMPANLLTHRGGRGEPLVLVHGLMGRGSTWARQLPWLTLLGAVYTYDA
PWHRGRDVADPHPISTERFVADLGDAVSALGAPTRMVGHSMGALHSWCLA
AERPELVSALVVEDMAPDFRGRTTGPWEPWLRALPVEFDSAEQVFAEFGP
VAGRYFLDAFDRTATGWRLHGRTARWIEIAAEWGTRDYWAQWRAVRSPAL
LIEAGDGVTPPGQMRAMAERDYPTAYLRVPDAGHLVHDEAPQVYRRAVES
FLAGLTP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRMPANLLTHRGGRGEPLVLVHGLMGRGSTWARQLPWLTLLGAVYTYDA
PWHRGRDVADPHPISTERFVADLGDAVSALGAPTRMVGHSMGALHSWCLA
AERPELVSALVVEDMAPDFRGRTTGPWEPWLRALPVEFDSAEQVFAEFGP
VAGRYFLDAFDRTATGWRLHGRTARWIEIAAEWGTRDYWAQWRAVRSPAL
LIEAGDGVTPPGQMRAMAERDYPTAYLRVPDAGHLVHDEAPQVYRRAVES
FLAGLTP

Graphical view for this nucleotide DNA sequence (805 bp): myctu-Rv3591c



References
3 more
    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: Functional characterization of hypothetical proteins of Mycobacterium tuberculosis with possible esterase/lipase signature: A Cumulative in silico and in vitro approach
    Kumar A, Sharma A, Kaur G, Makkar P, Kaur J
    Ref: J Biomol Struct Dyn, 35:1226, 2016 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer