myctu-Rv3802c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Culp6 Clp6, probable conserved membrane protein (hypothetical protein) Rv3802c MT3909 Mb3832c

Comment
Lacks cutinase activity has thioesterase and Phospholipase A (PLA) activity. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family Cutinase
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5W95: Mtb Rv3802c with PEG bound
No kinetic

Substrate: Cutin ,
Inhibitor: Pentaethylene-glycol ,
>3 Genbank links 13 more: BX248347, BX842584, AE000516
3 UniProt : O53581, A5U9D1, G0TKX9
1 Structure : 5W95
3 UniProtTrembl : O53581, A5U9D1, G0TKX9
3 Interpro : O53581, A5U9D1, G0TKX9
3 Prodom : O53581, A5U9D1, G0TKX9
3 Pfam : O53581, A5U9D1, G0TKX9
3 PIRSF : O53581, A5U9D1, G0TKX9
3 SUPERFAM : O53581, A5U9D1, G0TKX9
3 QuickSwissBlast : O53581, A5U9D1, G0TKX9
 
Sequence
Graphical view for this peptide sequence: myctu-Rv3802c
Colored MSA for Cutinase (raw)
MAKNSRRKRHRILAWIAAGAMASVVALVIVAVVIMLRGAESPPSAVPPGV
LPPGPTPAHPHKPRPAFQDASCPDVQMISVPGTWESSPQQNPLNPVQFPK
ALLLKVTGPIAQQFAPARVQTYTVAYTAQFHNPLTTDNQMSYNDSRAEGT
RAMVAAMTDMNNRCPLTSYVLIGFSQGAVIAGDVASDIGNGRGPVDEDLV
LGVTLIADGRRQQGVGNQVPPSPRGEGAEITLHEVPVLSGLGLTMTGPRP
GGFGALDGRTNEICAQGDLICAAPAQAFSPANLPTTLNTLAGGAGQPVHA
MYATPEFWNSDGEPATEWTLNWAHQLIENAPHPKHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKNSRRKRHRILAWIAAGAMASVVALVIVAVVIMLRGAESPPSAVPPGV
LPPGPTPAHPHKPRPAFQDASCPDVQMISVPGTWESSPQQNPLNPVQFPK
ALLLKVTGPIAQQFAPARVQTYTVAYTAQFHNPLTTDNQMSYNDSRAEGT
RAMVAAMTDMNNRCPLTSYVLIGFSQGAVIAGDVASDIGNGRGPVDEDLV
LGVTLIADGRRQQGVGNQVPPSPRGEGAEITLHEVPVLSGLGLTMTGPRP
GGFGALDGRTNEICAQGDLICAAPAQAFSPANLPTTLNTLAGGAGQPVHA
MYATPEFWNSDGEPATEWTLNWAHQLIENAPHPKHR

no DNA




References
18 more
    Title: Structural basis for lipid binding and mechanism of the Mycobacterium tuberculosis Rv3802 phospholipase
    Goins CM, Schreidah CM, Dajnowicz S, Ronning DR
    Ref: Journal of Biological Chemistry, 293:1363, 2018 : PubMed

            

    Title: Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification
    West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM, Britton WJ
    Ref: FASEB Journal, 23:1694, 2009 : PubMed

            

    Title: Identification of Mycobacterium avium genes that affect invasion of the intestinal epithelium
    Miltner E, Daroogheh K, Mehta PK, Cirillo SL, Cirillo JD, Bermudez LE
    Ref: Infect Immun, 73:4214, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer