myctu-a85a

 
Mycobacterium tuberculosis, Mycobacterium bovis, fibronectin-binding protein A FbpA Rv3804c

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1SFR: Mycobacterium Tuberculosis Antigen 85A
No kinetic

Substrate: alpha,alpha'-trehalose-6-mycolate ,
Inhibitor: CyC-17 ,
>3 Genbank links 16 more: NP_218321, WP_003900759, M27016
>3 UniProt links 6 more: P9WQP2, P9WQP3, A1KQD8
1 Structure : 1SFR
>3 UniProtTrembl links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 Interpro links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 Prodom links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 Pfam links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 PIRSF links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 SUPERFAM links 12 more: P9WQP2, D6MJP3, F2GDG3
>3 QuickSwissBlast links 12 more: P9WQP2, D6MJP3, F2GDG3
 
Sequence
Graphical view for this peptide sequence: myctu-a85a
Colored MSA for A85-Mycolyl-transferase (raw)
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLP
VEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPA
FEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPG
WLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQ
AMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRV
WVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLP
VEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPA
FEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPG
WLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQ
AMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRV
WVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

no DNA




References
17 more
    Title: A Screen for Protein-Protein Interactions in Live Mycobacteria Reveals a Functional Link between the Virulence-Associated Lipid Transporter LprG and the Mycolyltransferase Antigen 85A
    Touchette MH, Van Vlack ER, Bai L, Kim J, Cognetta AB, 3rd, Previti ML, Backus KM, Martin DW, Cravatt BF, Seeliger JC
    Ref: ACS Infect Dis, 3:336, 2017 : PubMed

            

    Title: High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets
    Harth G, Lee BY, Horwitz MA
    Ref: Infect Immun, 65:2321, 1997 : PubMed

            

    Title: Novel insights into the genetics, biochemistry, and immunocytochemistry of the 30-kilodalton major extracellular protein of Mycobacterium tuberculosis
    Harth G, Lee BY, Wang J, Clemens DL, Horwitz MA
    Ref: Infect Immun, 64:3038, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer