myctu-a85b

 
Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium microti, fibronectin-binding protein Bcomplex Bag85B fbpB Rv1886c

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains Q9R667 fragments Wiker et al


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 1F0N, 1F0P, 5TS1... more)
No kinetic

Substrate: alpha,alpha'-trehalose-6-mycolate ,
Inhibitor: EZ120P , EZ120 ,
>3 Genbank links 17 more: AM408590, BX248340, BX842578
>3 UniProt links 2 more: P9WQP1, A1KJU9, P0C2T2
>3 Structure links 1 more: 1F0N, 1F0P, 5TS1
>3 UniProtTrembl links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 Interpro links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 Prodom links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 Pfam links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 PIRSF links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 SUPERFAM links 6 more: P9WQP1, A1KJU9, P0C2T2
>3 QuickSwissBlast links 6 more: P9WQP1, A1KJU9, P0C2T2
 
Sequence
Graphical view for this peptide sequence: myctu-a85b
Colored MSA for A85-Mycolyl-transferase (raw)
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEY
LQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLS
ANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVY
CGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG
THSWEYWGAQLNAMKGDLQSSLGAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEY
LQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLS
ANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVY
CGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG
THSWEYWGAQLNAMKGDLQSSLGAG

no DNA




References
14 more
    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer