myctu-d5yk66

 
Mycobacterium tuberculosis, Mycobacterium bovis, Putative uncharacterized protein MT3543 RV3438 Mb3468

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block L
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 18 more: DS985167, AE000516, BX842583
2 UniProt : O06255, A5U8B4
2 UniProtTrembl : O06255, A5U8B4
2 Interpro : O06255, A5U8B4
2 Prodom : O06255, A5U8B4
2 Pfam : O06255, A5U8B4
2 PIRSF : O06255, A5U8B4
2 SUPERFAM : O06255, A5U8B4
2 QuickSwissBlast : O06255, A5U8B4
 
Sequence
Graphical view for this peptide sequence: myctu-d5yk66
Colored MSA for Chlorophyllase (raw)
MPRIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEAGLHLPGVAFGHD
WLTGTSRYSGLLEHLASWGIVAAAPDSERGLAPSVLNLAFDLGVALDIVA
GVRLGPGKISVHPAKLGLVGHGFGGSAAVFAAAGLTGTHVKSVAAIFPTV
TNPAAEQPAATLDVPGLILTAPGDPKTLTSNALGLSRAWDKATLRIVSKA
RAGGLVEGRRLTKVLGLPGPHRRTQRSVRALLTGYLLYTLGGDKTYRRFA
DPDLQLPKTDPIDPEAPPITPGEKIVTLLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEAGLHLPGVAFGHD
WLTGTSRYSGLLEHLASWGIVAAAPDSERGLAPSVLNLAFDLGVALDIVA
GVRLGPGKISVHPAKLGLVGHGFGGSAAVFAAAGLTGTHVKSVAAIFPTV
TNPAAEQPAATLDVPGLILTAPGDPKTLTSNALGLSRAWDKATLRIVSKA
RAGGLVEGRRLTKVLGLPGPHRRTQRSVRALLTGYLLYTLGGDKTYRRFA
DPDLQLPKTDPIDPEAPPITPGEKIVTLLK

no DNA




References
4 more
    Title: Re-annotation of the genome sequence of Mycobacterium tuberculosis H37Rv
    Camus JC, Pryor MJ, Medigue C, Cole ST
    Ref: Microbiology, 148:2967, 2002 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer