myctu-lipv

 
Mycobacterium tuberculosis H37Rv Mycobacterium bovis Lipase LipV MT3298 Rv3203

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 36 more: NP_217719, WP_003899968, CCP46018
3 UniProt : L0TC47, A5U7M4, Q8VJ49
1 Ncbi-nid : 3261739
1 Ncbi-pid : 3261740
>3 UniProtTrembl links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 Interpro links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 Prodom links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 Pfam links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 PIRSF links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 SUPERFAM links 6 more: L0TC47, Q8VJ49, A5U7M4
>3 QuickSwissBlast links 6 more: L0TC47, Q8VJ49, A5U7M4
 
Sequence
Graphical view for this peptide sequence: myctu-lipv
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MIIDLHVQRYGPSGPARVLTIHGVTEHGRIWHRLAHHLPEIPIAAPDLLG
HGRSPWAAPWTIDANVSALAALLDNQGDGPVVVVGHSFGGAVAMHLAAAR
PDQVAALVLLDPAVALDGSRVREVVDAMLASPDYLDPAEARAEKATGAWA
DVDPPVLDAELDEHLVALPNGRYGWRISLPAMVCYWSELARDIVLPPVGT
ATTLVRAVRASPAYVSDQLLAALDKRLGADFELLDFDCGHMVPQAKPTEV
AAVIRSRLGPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIIDLHVQRYGPSGPARVLTIHGVTEHGRIWHRLAHHLPEIPIAAPDLLG
HGRSPWAAPWTIDANVSALAALLDNQGDGPVVVVGHSFGGAVAMHLAAAR
PDQVAALVLLDPAVALDGSRVREVVDAMLASPDYLDPAEARAEKATGAWA
DVDPPVLDAELDEHLVALPNGRYGWRISLPAMVCYWSELARDIVLPPVGT
ATTLVRAVRASPAYVSDQLLAALDKRLGADFELLDFDCGHMVPQAKPTEV
AAVIRSRLGPR

Graphical view for this nucleotide DNA sequence (701 bp): myctu-lipv



References
2 more
    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer