myctu-metx

 
Mycobacterium tuberculosis, Mycobacterium bovis, homoserine transacetylase (hta) metXA MetA Rv3341

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6PUX: Homoserine transacetylase MetA from Mycobacterium tuberculosis
No kinetic



>3 Genbank links 19 more: WP_003417458, AL021841, BX248345
>3 UniProt links 3 more: P9WJY9, P0A5J9, A1KP32
1 Structure : 6PUX
>3 UniProtTrembl links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 Interpro links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 Prodom links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 Pfam links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 PIRSF links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 SUPERFAM links 12 more: P0A5J9, P9WJY8, L0TDV2
>3 QuickSwissBlast links 12 more: P0A5J9, P9WJY8, L0TDV2
 
Sequence
Graphical view for this peptide sequence: myctu-metx
Colored MSA for Homoserine_transacetylase (raw)
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPAR
DNVVVVLHALTGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVAT
NVLGGCRGSTGPSSLARDGKPWGSRFPLISIRDQVQADVAALAALGITEV
AAVVGGSMGGARALEWVVGYPDRVRAGLLLAVGARATADQIGTQTTQIAA
IKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIELDTRFANHNQG
NEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGG
VSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGH
DGFLVETEAVGELIRQTLGLADREGACRR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPAR
DNVVVVLHALTGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVAT
NVLGGCRGSTGPSSLARDGKPWGSRFPLISIRDQVQADVAALAALGITEV
AAVVGGSMGGARALEWVVGYPDRVRAGLLLAVGARATADQIGTQTTQIAA
IKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIELDTRFANHNQG
NEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGG
VSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGH
DGFLVETEAVGELIRQTLGLADREGACRR

no DNA




References
5 more
    Title: MetA (Rv3341) from Mycobacterium tuberculosis H37Rv strain exhibits substrate dependent dual role of transferase and hydrolase activity
    Maurya B, Pochet L, Wouters J, Colaco M, Misquith S
    Ref: Biochimie, 179:113, 2020 : PubMed

            

    Title: Structural analysis of mycobacterial homoserine transacetylases central to methionine biosynthesis reveals druggable active site
    Chaton CT, Rodriguez ES, Reed RW, Li J, Kenner CW, Korotkov KV
    Ref: Sci Rep, 9:20267, 2019 : PubMed

            

    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer