myctu-ppe63

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv3539, MT3643 ppe63 PPE family protein

Comment
Other strains: Mycobacterium tuberculosis (strains C; ATCC 25177/H37Ra; Haarlem; F11; GM 1503; W-148; SUMu003; CDC1551A; 94_M4241A; EAS054; T92; T85; KZN 1435 / MDR; SUMu004; KZN 4207; T17; SUMu012; 02_1987; K85) Mycobacterium bovis (strains BCG/Tokyo172/ATCC35737/TMC1019; BCG/Pasteur1173P2)


Relationship
Family PE-PPE
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 6 more: CH482376, CP000611, DS016978
3 UniProt : A5U8L3, P9WHX4, P9WHX5
3 UniProtTrembl : P9WHX4, P9WHX5, A5U8L3
3 Interpro : P9WHX4, P9WHX5, A5U8L3
3 Prodom : P9WHX4, P9WHX5, A5U8L3
3 Pfam : P9WHX4, P9WHX5, A5U8L3
3 PIRSF : P9WHX4, P9WHX5, A5U8L3
3 SUPERFAM : P9WHX4, P9WHX5, A5U8L3
3 QuickSwissBlast : P9WHX4, P9WHX5, A5U8L3
 
Sequence
Graphical view for this peptide sequence: myctu-ppe63
Colored MSA for PE-PPE (raw)
MADFLTLSPEVNSARMYAGGGPGSLSAAAAAWDELAAELWLAAASFESVC
SGLADRWWQGPSSRMMAAQAARHTGWLAAAATQAEGAASQAQTMALAYEA
AFAATVHPALVAANRALVAWLAGSNVFGQNTPAIAAAEAIYEQMWAQDVV
AMLNYHAVASAVGARLRPWQQLLHELPRRLGGEHSDSTNTELANPSSTTT
RITVPGASPVHAATLLPFIGRLLAARYAELNTAIGTNWFPGTTPEVVSYP
ATIGVLSGSLGAVDANQSIAIGQQMLHNEILAATASGQPVTVAGLSMGSM
VIDRELAYLAIDPNAPPSSALTFVELAGPERGLAQTYLPVGTTIPIAGYT
VGNAPESQYNTSVVYSQYDIWADPPDRPWNLLAGANALMGAAYFHDLTAY
AAPQQGIEIAAVTSSLGGTTTTYMIPSPTLPLLLPLKQIGVPDWIVGGLN
NVLKPLVDAGYSQYAPTAGPYFSHGNLVW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADFLTLSPEVNSARMYAGGGPGSLSAAAAAWDELAAELWLAAASFESVC
SGLADRWWQGPSSRMMAAQAARHTGWLAAAATQAEGAASQAQTMALAYEA
AFAATVHPALVAANRALVAWLAGSNVFGQNTPAIAAAEAIYEQMWAQDVV
AMLNYHAVASAVGARLRPWQQLLHELPRRLGGEHSDSTNTELANPSSTTT
RITVPGASPVHAATLLPFIGRLLAARYAELNTAIGTNWFPGTTPEVVSYP
ATIGVLSGSLGAVDANQSIAIGQQMLHNEILAATASGQPVTVAGLSMGSM
VIDRELAYLAIDPNAPPSSALTFVELAGPERGLAQTYLPVGTTIPIAGYT
VGNAPESQYNTSVVYSQYDIWADPPDRPWNLLAGANALMGAAYFHDLTAY
AAPQQGIEIAAVTSSLGGTTTTYMIPSPTLPLLLPLKQIGVPDWIVGGLN
NVLKPLVDAGYSQYAPTAGPYFSHGNLVW

no DNA




References
3 more
    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer