myctu-yc88

 
Mycobacterium tuberculosis, Mycobacterium bovis, hypothetical 49.6 kda protein rv1288

Comment
A two Domain, cell wall anchored, nutrient stress inducible Carboxyl-Esterase (Maan et al. 2018. Only c-term Pfam A Esterase 181 440 included here. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 9 more: BX248338, Z73419, AE007007
3 UniProt : A5U1Y6, P9WM38, P9WM39
3 UniProtTrembl : P9WM38, P9WM39, A5U1Y6
3 Interpro : P9WM38, P9WM39, A5U1Y6
3 Prodom : P9WM38, P9WM39, A5U1Y6
3 Pfam : P9WM38, P9WM39, A5U1Y6
3 PIRSF : P9WM38, P9WM39, A5U1Y6
3 SUPERFAM : P9WM38, P9WM39, A5U1Y6
3 QuickSwissBlast : P9WM38, P9WM39, A5U1Y6
 
Sequence
Graphical view for this peptide sequence: myctu-yc88
Colored MSA for A85-Mycolyl-transferase (raw)
GLRIVDRNENDPRLWYYRFQTSAIGWNPGVNVLLPDDYRTSGRTYPVLYL
FHGGGTDQDFRTFDFLGIRDLTAGKPIIIVMPDGGHAGWYSNPVSSFVGP
RNWETFHIAQLLPWIEANFRTYAEYDGRAVAGFSMGGFGALKYAAKYYGH
FASASSHSGPASLRRDFGLVVHWANLSSAVLDLGGGTVYGAPLWDQARVS
ADNPVERIDSYRNKRIFLVAGTSPDPANWFDSVNETQVLAGQREFRERLS
NAGIPHESHEVPGGHVFRPDMFRLDLDGIVARLRPASIGAAAERAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GLRIVDRNENDPRLWYYRFQTSAIGWNPGVNVLLPDDYRTSGRTYPVLYL
FHGGGTDQDFRTFDFLGIRDLTAGKPIIIVMPDGGHAGWYSNPVSSFVGP
RNWETFHIAQLLPWIEANFRTYAEYDGRAVAGFSMGGFGALKYAAKYYGH
FASASSHSGPASLRRDFGLVVHWANLSSAVLDLGGGTVYGAPLWDQARVS
ADNPVERIDSYRNKRIFLVAGTSPDPANWFDSVNETQVLAGQREFRERLS
NAGIPHESHEVPGGHVFRPDMFRLDLDGIVARLRPASIGAAAERAD

no DNA




References
5 more
    Title: Rv1288, a Two Domain, Cell Wall Anchored, Nutrient Stress Inducible Carboxyl-Esterase of Mycobacterium tuberculosis, Modulates Cell Wall Lipid
    Maan P, Kumar A, Kaur J
    Ref: Front Cell Infect Microbiol, 8:421, 2018 : PubMed

            

    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: In-Silico Characterization of a Hypothetical Protein, Rv1288 of Mycobacterium tuberculosis Containing an Esterase Signature and an Uncommon LytE Domain
    Kumar A, Maan P, Singh G, Kaur J
    Ref: Curr Comput Aided Drug Des, 13:101, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer