myctu-ym24

 
Mycobacterium tuberculosis, Mycobacterium bovis Carboxylesterase A, caeA, rv2224c MT2282, Hydrolase important for pathogenesis 1 (Hip1)

Comment
Hydrolase important for pathogenesis 1 (Hip1, rv2224c). Serine protease that promotes tuberculosis (TB) pathogenesis by promoting the processing and the extracellular release of the M.tuberculosis (Mtb) heat-shock protein GroEL2. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
6 structures (e.g. : 7SFM, 7M7C, 5BKM... more)
No kinetic

Substrate: CSL174 ,

>3 Genbank links 1 more: Z70692, BX248341, BX842579
>3 UniProt links 1 more: P9WHR2, P9WHR3, P65824
>3 Structure links 3 more: 7SFM, 7M7C, 5BKM
>3 UniProtTrembl links 1 more: P65824, P9WHR3, P9WHR2
>3 Interpro links 1 more: P65824, P9WHR3, P9WHR2
>3 Prodom links 1 more: P65824, P9WHR3, P9WHR2
>3 Pfam links 1 more: P65824, P9WHR3, P9WHR2
>3 PIRSF links 1 more: P65824, P9WHR3, P9WHR2
>3 SUPERFAM links 1 more: P65824, P9WHR3, P9WHR2
>3 QuickSwissBlast links 1 more: P65824, P9WHR3, P9WHR2
 
Sequence
Graphical view for this peptide sequence: myctu-ym24
Colored MSA for AlphaBeta_hydrolase (raw)
MGMRLSRRDKIARMLLIWAALAAVALVLVGCIRVVGGRARMAEPKLGQPV
EWTPCRSSNPQVKIPGGALCGKLAVPVDYDRPDGDVAALALIRFPATGDK
IGSLVINPGGPGESGIEAALGVFQTLPKRVHERFDLVGFDPRGVASSRPA
IWCNSDADNDRLRAEPQVDYSREGVAHIENETKQFVGRCVDKMGKNFLAH
VGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGSAYAEEFPQRVRAMIL
DGAVDPNADPIEAELRQAKGFQDAFNNYAADCAKNAGCPLGADPAKAVEV
YHSLVDPLVDPDNPRISRPARTKDPRGLSYSDAIVGTIMALYSPNLWQHL
TDGLSELVDNRGDTLLALADMYMRRDSHGRYNNSGDARVAINCVDQPPVT
DRDKVIDEDRRAREIAPFMSYGKFTGDAPLGTCAFWPVPPTSQPHAVSAP
GLVPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCI
DEYVTAYLIGGTTPPSGAKC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGMRLSRRDKIARMLLIWAALAAVALVLVGCIRVVGGRARMAEPKLGQPV
EWTPCRSSNPQVKIPGGALCGKLAVPVDYDRPDGDVAALALIRFPATGDK
IGSLVINPGGPGESGIEAALGVFQTLPKRVHERFDLVGFDPRGVASSRPA
IWCNSDADNDRLRAEPQVDYSREGVAHIENETKQFVGRCVDKMGKNFLAH
VGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGSAYAEEFPQRVRAMIL
DGAVDPNADPIEAELRQAKGFQDAFNNYAADCAKNAGCPLGADPAKAVEV
YHSLVDPLVDPDNPRISRPARTKDPRGLSYSDAIVGTIMALYSPNLWQHL
TDGLSELVDNRGDTLLALADMYMRRDSHGRYNNSGDARVAINCVDQPPVT
DRDKVIDEDRRAREIAPFMSYGKFTGDAPLGTCAFWPVPPTSQPHAVSAP
GLVPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCI
DEYVTAYLIGGTTPPSGAKC

no DNA




References
14 more
    Title: Structure Determination of Mycobacterium tuberculosis Serine Protease Hip1 (Rv2224c)
    Naffin-Olivos JL, Daab A, White A, Goldfarb NE, Milne AC, Liu D, Baikovitz J, Dunn BM, Rengarajan J and Ringe D <1 more author(s)>
    Ref: Biochemistry, 56:2304, 2017 : PubMed

            

    Title: Design of Selective Substrates and Activity-Based Probes for Hydrolase Important for Pathogenesis 1 (HIP1) from Mycobacterium tuberculosis
    Lentz CS, Ordonez AA, Kasperkiewicz P, La Greca F, O'Donoghue AJ, Schulze CJ, Powers JC, Craik CS, Drag M and Bogyo M <1 more author(s)>
    Ref: ACS Infect Dis, 2:807, 2016 : PubMed

            

    Title: Mycobacterium tuberculosis Rv2224c modulates innate immune responses
    Rengarajan J, Murphy E, Park A, Krone CL, Hett EC, Bloom BR, Glimcher LH, Rubin EJ
    Ref: Proc Natl Acad Sci U S A, 105:264, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer