Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-yt28

Mycobacterium tuberculosis, Mycobacterium bovis probable thioesterase tesa TesA rv2928 (EC 3.1.2.-)

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 6FVJ, 6FW5
No kinetic





No Substrate
1 inhbitor:
CyC-17
>3 Genbank links 2 more: BX248344, Z74697, AE007121
>3 UniProt links 2 more: P9WQD4, P9WQD5, P63461
2 Structure : 6FVJ, 6FW5
>3 UniProt links 1 more: P9WQD4, P9WQD5, P63461
>3 Interpro links 1 more: P9WQD4, P9WQD5, P63461
>3 Pfam links 1 more: P9WQD4, P9WQD5, P63461
>3 PIRSF links 1 more: P9WQD4, P9WQD5, P63461
>3 SUPERFAM links 1 more: P9WQD4, P9WQD5, P63461
Sequence
Graphical view for this peptide sequence: myctu-yt28
Colored MSA for Thioesterase (raw)
MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSRE
FSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDRE
MLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDI
EDKTLQWHDRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSRE
FSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDRE
MLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDI
EDKTLQWHDRA


References
9 more
    Title: Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis
    Nguyen PC, Nguyen VS, Martin BP, Fourquet P, Camoin L, Spilling CD, Cavalier JF, Cambillau C, Canaan S
    Ref: Journal of Molecular Biology, 430:5120, 2018 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer