Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myolu-g1q061

Myotis lucifugus (Little brown bat). FSH1 domain-containing protein

Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Myotis lucifugus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Chiroptera: N E > Microchiroptera: N E > Vespertilionidae: N E > Myotis: N E > Myotis lucifugus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAPE02038104, XP_006099234.2
1 UniProt : G1Q061
1 UniProt : G1Q061
1 Interpro : G1Q061
1 Prodom : G1Q061
1 Pfam : G1Q061
1 PIRSF : G1Q061
1 SUPERFAM : G1Q061
Sequence
Graphical view for this peptide sequence: myolu-g1q061
Colored MSA for FSH1 (raw)
MAAPQPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPIVD
PAGAGPESGSCPPEEQPRGWWFSEQGADVFSALEEPAVCRGLEEALGTVA
QALNELGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFIILVSGFCL
RGLGLQESVLQGPLSLPSLHVFGDTDRVIPSQESMQLASRFTGSTTLTHS
GGHFIPAAAPQRQAYLKFLDQFAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAPQPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPIVD
PAGAGPESGSCPPEEQPRGWWFSEQGADVFSALEEPAVCRGLEEALGTVA
QALNELGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFIILVSGFCL
RGLGLQESVLQGPLSLPSLHVFGDTDRVIPSQESMQLASRFTGSTTLTHS
GGHFIPAAAPQRQAYLKFLDQFAE


Reference
    Title: A high-resolution map of human evolutionary constraint using 29 mammals
    Lindblad-Toh K, Garber M, Zuk O, Lin MF, Parker BJ, Washietl S, Kheradpour P, Ernst J, Jordan G and Kellis M <76 more author(s)>
    Ref: Nature, 478:476, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer