Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myzpe-ACHE

Myzus persicae (Peach-potato aphid) acetylcholinesterase MpAChE1 ache-b ,ache2 gene

Comment
Q8I823 AY162275 (Gatehouse H.S., Gatehouse L.N.) and AF287291 (Nabeshima,T., Kono,Y. and Tomita,T)differ in 2 aa out of 189 overlap and AJ576070 (Javed et al differ in 4 aa from AF28729


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Myzus persicae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Macrosiphini: N E > Myzus: N E > Myzus persicae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AF287291, AJ576070, AY162275
1 Ncbi-nid : 19850153
1 Ncbi-pid : 19850154
3 UniProt : Q8T7U9, Q8I823, Q7YZQ0
3 Interpro : Q8T7U9, Q8I823, Q7YZQ0
3 Prodom : Q8T7U9, Q8I823, Q7YZQ0
3 Pfam : Q8T7U9, Q8I823, Q7YZQ0
3 PIRSF : Q8T7U9, Q8I823, Q7YZQ0
3 SUPERFAM : Q8T7U9, Q8I823, Q7YZQ0
Sequence
Graphical view for this peptide sequence: myzpe-ACHE
Colored MSA for ACHE (raw)
MSVDCVYTSAVTLLLCCSAVLGRPSSNGGADGGGGGGGGGGAGAGGSGGG
GGGGGGGSGVDDTDESPVVVTSSGMVQGYTKIIANREVRVYTGIPFAKPP
VGPLRFRRPVAVDPWTGVLNATRLPNTCYQERYEYFPGFVGEEMWNPNTK
LSEDCLYLNIWIPKKQRTRHHSNNAHHAKIPVLVWIYGGGYMSGTSTLDI
YDGDLLAATFDVMIASMQYRLGAFGSLYLTPELPEDSDDAPGNMGLWDQA
LAIKWIKENAAAFGADPETITLFGESAGGGSVSVHLISPETRGMVRRGII
QSGTVNAPWSYMTGERAVDIAKKLLDDCNCNSTTLDSNPIATMSCMRAVD
ASTISKKQWNNYSGILGFPSAPTVDGVLLPEHPLDMLAKANFSDIDILIG
SNLNEGTYFLLYDFVDFFDRTSATALPKEKFVQIVNVIFKDKTQLERDAI
IYQYSGWEKKDVDDKYSNQKQLSDVVADYFFVCPTNLFANIVSSRGARVY
YYFFTHRTDSHLWGEWMGVLHGDEMQYVFGHPLNMSMPYNARERDLSIRI
MEAFTRFSLTGTPVSDDIDWPLYNESNPIYHVWNAAELHVGYGPRAAECQ
FWNGFFPKIAQALKETSKITCEDYPDSMPTTNENCTFTSSFASINPQISF
AIIFIFVLPAHGLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVDCVYTSAVTLLLCCSAVLGRPSSNGGADGGGGGGGGGGAGAGGSGGG
GGGGGGGSGVDDTDESPVVVTSSGMVQGYTKIIANREVRVYTGIPFAKPP
VGPLRFRRPVAVDPWTGVLNATRLPNTCYQERYEYFPGFVGEEMWNPNTK
LSEDCLYLNIWIPKKQRTRHHSNNAHHAKIPVLVWIYGGGYMSGTSTLDI
YDGDLLAATFDVMIASMQYRLGAFGSLYLTPELPEDSDDAPGNMGLWDQA
LAIKWIKENAAAFGADPETITLFGESAGGGSVSVHLISPETRGMVRRGII
QSGTVNAPWSYMTGERAVDIAKKLLDDCNCNSTTLDSNPIATMSCMRAVD
ASTISKKQWNNYSGILGFPSAPTVDGVLLPEHPLDMLAKANFSDIDILIG
SNLNEGTYFLLYDFVDFFDRTSATALPKEKFVQIVNVIFKDKTQLERDAI
IYQYSGWEKKDVDDKYSNQKQLSDVVADYFFVCPTNLFANIVSSRGARVY
YYFFTHRTDSHLWGEWMGVLHGDEMQYVFGHPLNMSMPYNARERDLSIRI
MEAFTRFSLTGTPVSDDIDWPLYNESNPIYHVWNAAELHVGYGPRAAECQ
FWNGFFPKIAQALKETSKITCEDYPDSMPTTNENCTFTSSFASINPQISF
AIIFIFVLPAHGLL


References
    Title: Characterization of acetylcholinesterases, and their genes, from the hemipteran species Myzus persicae (Sulzer), Aphis gossypii (Glover), Bemisia tabaci (Gennadius) and Trialeurodes vaporariorum (Westwood)
    Javed N, Viner R, Williamson MS, Field LM, Devonshire AL, Moores GD
    Ref: Insect Molecular Biology, 12:613, 2003 : PubMed

            

    Title: An amino acid substitution on the second acetylcholinesterase in the pirimicarb-resistant strains of the peach potato aphid, Myzus persicae
    Nabeshima T, Kozaki T, Tomita T, Kono Y
    Ref: Biochemical & Biophysical Research Communications, 307:15, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer