Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myzpe-ACHEm

Myzus persicae (Peach-potato aphid) acetylcholinesterase MpAChE2 ache-m

Comment
Gatehouse H.S., Gatehouse L.N. partial sequence AY162274


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Myzus persicae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Macrosiphini: N E > Myzus: N E > Myzus persicae: N E


Molecular evidence
Database
1 mutation: myzpe-ACHEm
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AY162274, AY147797, KJ561353
2 UniProt : Q2TVM5, A0A059WRR7
1 Ncbi-nid : 26518493
1 Ncbi-pid : 26518494
3 UniProt : Q8I824, Q2TVM5, A0A059WRR7
3 Interpro : Q8I824, Q2TVM5, A0A059WRR7
3 Prodom : Q8I824, Q2TVM5, A0A059WRR7
3 Pfam : Q8I824, Q2TVM5, A0A059WRR7
3 PIRSF : Q8I824, Q2TVM5, A0A059WRR7
3 SUPERFAM : Q8I824, Q2TVM5, A0A059WRR7
Sequence
Graphical view for this peptide sequence: myzpe-ACHEm
Colored MSA for ACHE (raw)
MDQWLLWFSYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDNDFESSGETYSAYKSDD
PLVIHTNKGKIRGITQAASTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDNTNPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKPRPQNAAVMVWIFGGGFYSGSATLDIYDPKVLVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESYSRGLRLA
RAMGCPDDRNEIHKTVECLRKANSSTMVEKEWDHVAICFFPFVPVVDGAF
LDDYPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVVVSR
ENFVKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTFEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLMAISKSMKSDKNCTT
ISGGTKTYMIELSLWTIVMTTAVLML
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDQWLLWFSYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDNDFESSGETYSAYKSDD
PLVIHTNKGKIRGITQAASTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDNTNPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPKPRPQNAAVMVWIFGGGFYSGSATLDIYDPKVLVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESYSRGLRLA
RAMGCPDDRNEIHKTVECLRKANSSTMVEKEWDHVAICFFPFVPVVDGAF
LDDYPQKSLSTNNFKKTNILMGSNSEEGYYSIFYYLTELFKKEENVVVSR
ENFVKAIGQLNPNADAAVKSAIEFEYTDWFSPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTFEGSWVTPKWPVHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLMAISKSMKSDKNCTT
ISGGTKTYMIELSLWTIVMTTAVLML


Reference
    Title: An amino acid substitution on the second acetylcholinesterase in the pirimicarb-resistant strains of the peach potato aphid, Myzus persicae
    Nabeshima T, Kozaki T, Tomita T, Kono Y
    Ref: Biochemical & Biophysical Research Communications, 307:15, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer