Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neime-NMA2216

Neisseria meningitidis, Neisseria lactamica, Neisseria cinerea, putative hydrolase

Comment
Other strains: Neisseria meningitidis (serogroup ; serogroup B; serogroup C (strains 8013; 053442) / serotype 2a (strain ATCC 700532 / FAM18; alpha153; alpha14; alpha275; serotype 15 (strain H44/76)) Neisseria lactamica ATCC 23970 Neisseria cinerea ATCC 14685


Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Neisseria meningitidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Neisseriaceae: N E > Neisseria: N E > Neisseria meningitidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: neime-NMA2216
Colored MSA for BioH (raw)
MRRQQERKSMPDAVKKVYLIHGWGANRHVFDDLMPRLPATWPVSAVDLPG
HGDAPFAQPFDIEAAADAVAAQIDTPADILGWSLGGLVALYLAARHPDKV
RSLCLTASFARLTADEDYPEGLAAPALGKMVGAFRTDYAKHIKQFLQLQL
LHTPDADGIIGRILPDLARCGTPSALQEALDAAERADARHLLDKIDVPVL
LVFGGKDAITPPRMGEYLHRRLKGSRLVVMEKAAHAPFLSHAEAFAALYR
DFVEGVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRRQQERKSMPDAVKKVYLIHGWGANRHVFDDLMPRLPATWPVSAVDLPG
HGDAPFAQPFDIEAAADAVAAQIDTPADILGWSLGGLVALYLAARHPDKV
RSLCLTASFARLTADEDYPEGLAAPALGKMVGAFRTDYAKHIKQFLQLQL
LHTPDADGIIGRILPDLARCGTPSALQEALDAAERADARHLLDKIDVPVL
LVFGGKDAITPPRMGEYLHRRLKGSRLVVMEKAAHAPFLSHAEAFAALYR
DFVEGVL


References
6 more
    Title: Purification and characterisation of the BIOH protein from the biotin biosynthetic pathway
    Tomczyk NH, Nettleship JE, Baxter RL, Crichton HJ, Webster SP, Campopiano DJ
    Ref: FEBS Letters, 513:299, 2002 : PubMed

            

    Title: Complete DNA sequence of a serogroup A strain of Neisseria meningitidis Z2491
    Parkhill J, Achtman M, James KD, Bentley SD, Churcher C, Klee SR, Morelli G, Basham D, Brown D and Barrell BG <18 more author(s)>
    Ref: Nature, 404:502, 2000 : PubMed

            

    Title: Complete genome sequence of Neisseria meningitidis serogroup B strain MC58
    Tettelin H, Saunders NJ, Heidelberg J, Jeffries AC, Nelson KE, Eisen JA, Ketchum KA, Hood DW, Peden JF and Venter JC <32 more author(s)>
    Ref: Science, 287:1809, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer