Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neime-NMB0868

Neisseria meningitidis (serogroup B) hypothetical protein nmb0868

Relationship
Family|Atu1826-like
Block| X
Position in NCBI Life Tree|Neisseria meningitidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Neisseriaceae: N E > Neisseria: N E > Neisseria meningitidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE002439
1 UniProt : Q9JZW7
1 Interpro : Q9JZW7
1 Prodom : Q9JZW7
1 Pfam : Q9JZW7
1 PIRSF : Q9JZW7
1 SUPERFAM : Q9JZW7
Sequence
Graphical view for this peptide sequence: neime-NMB0868
Colored MSA for Atu1826-like (raw)
MLKPETIHISGPAGILETIHIPSEQVPARGVAVINHPNPLQGGTNTNKVI
QTAAKALSKLGFHCYLPNLRGVGGSGGTHDYGRGETQDCLAVIDYARAQH
PEAPEFALSGFSFGGYVATFAAQARTPDLLLLIGAAVCHYTDRPEPSAVP
NVAKTLMIHGAEDEVVEIGKALKWAEPQDLPVITIAGSTHFFHGKLIVLR
DTILRFAPVCLNG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLKPETIHISGPAGILETIHIPSEQVPARGVAVINHPNPLQGGTNTNKVI
QTAAKALSKLGFHCYLPNLRGVGGSGGTHDYGRGETQDCLAVIDYARAQH
PEAPEFALSGFSFGGYVATFAAQARTPDLLLLIGAAVCHYTDRPEPSAVP
NVAKTLMIHGAEDEVVEIGKALKWAEPQDLPVITIAGSTHFFHGKLIVLR
DTILRFAPVCLNG


Reference
    Title: Complete genome sequence of Neisseria meningitidis serogroup B strain MC58
    Tettelin H, Saunders NJ, Heidelberg J, Jeffries AC, Nelson KE, Eisen JA, Ketchum KA, Hood DW, Peden JF and Venter JC <32 more author(s)>
    Ref: Science, 287:1809, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer