neofi-a1cwa6

 
Neosartorya fischeri ; Neosartorya fumigata (Aspergillus fumigatus); Aspergillus novofumigatus; Aspergillus lentulus; Aspergillus turcosus; Aspergillus thermomutatus; toxin biosynthesis protein, putative

Comment
Other strains: Neosartorya fischeri (Aspergillus fischerianus(strain ATCC 1020 / DSM 3700 / NRRL 181)); Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus); Aspergillus novofumigatus IBT 16806; Aspergillus lentulus; Aspergillus turcosus; Aspergillus thermomutatus


Relationship
Family MpaH
Block X
Neosartorya fischeri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fischeri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: DS027685, XP_001266805, AAHF01000005
>3 UniProt links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 UniProtTrembl links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 Interpro links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 Prodom links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 Pfam links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 PIRSF links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 SUPERFAM links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
>3 QuickSwissBlast links 3 more: A1CWA6, Q4WQC3, A0A2I1C4K2
 
Sequence
Graphical view for this peptide sequence: neofi-a1cwa6
Colored MSA for MpaH (raw)
MSLSSSSISGPFRIVEHVVECQHIREYPAATANEQEDILHLAVKQYVPLD
NPEPQPGDVTILAAHANGFPKELYEPLWEEIYARSKANGFRIRSIWMADV
AHQGQSSVLNEDLLGNDPSWFDHPRDLLHLVNVKRKEMPRPIVGIGHSMG
GAHLAQLSLMHPRLIHSLVLLDPVIQRQTTQLEPRPLFKDQLVIAKTTQL
STYRRDKWPSRKAAAEAFKKNPFYQTWDARVLDRWIKYGLRDLPTAVHPL
DDTATSQGSDRPVTLTTTLHQEVFTFSRPNYDGPPGKNVPINRVTHPDLN
PKHVGSFPFYRPEPSRIFAQLEHLRPSVLYIFAGKSDMCLPEMMADKMKN
TGTGLGGSGGAAEGRVRDVYLENYGHLLAQEAPSECGEAASRWLGKELER
WRAEEQAFRDQWSKKSKIERVTIDSRWKEHVPAPVRPKKDSKAKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLSSSSISGPFRIVEHVVECQHIREYPAATANEQEDILHLAVKQYVPLD
NPEPQPGDVTILAAHANGFPKELYEPLWEEIYARSKANGFRIRSIWMADV
AHQGQSSVLNEDLLGNDPSWFDHPRDLLHLVNVKRKEMPRPIVGIGHSMG
GAHLAQLSLMHPRLIHSLVLLDPVIQRQTTQLEPRPLFKDQLVIAKTTQL
STYRRDKWPSRKAAAEAFKKNPFYQTWDARVLDRWIKYGLRDLPTAVHPL
DDTATSQGSDRPVTLTTTLHQEVFTFSRPNYDGPPGKNVPINRVTHPDLN
PKHVGSFPFYRPEPSRIFAQLEHLRPSVLYIFAGKSDMCLPEMMADKMKN
TGTGLGGSGGAAEGRVRDVYLENYGHLLAQEAPSECGEAASRWLGKELER
WRAEEQAFRDQWSKKSKIERVTIDSRWKEHVPAPVRPKKDSKAKL

no DNA




References
    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer