neofi-a1da82

 
Neosartorya fischeri (Aspergillus fischerianus); Aspergillus novofumigatus; Aspergillus udagawae; Penicillium arizonense. Hydrolase_4 domain-containing protein

Comment
Other strains: Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus); Aspergillus novofumigatus IBT 16806; Aspergillus udagawae; Penicillium arizonense. Hydrolase_4 domain-containing protein


Relationship
Block X
Neosartorya fischeri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fischeri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



 
Sequence
Graphical view for this peptide sequence: neofi-a1da82
Colored MSA for Thiohydrolase (raw)
MDREDVEFPTFDGLTLRGWLCPGTIRGPAIVMNQGFNTPKEILLPDVALW
FQQQGVTVLLYDNRCIGASDGEPRNDVKPAKLVEDFHDALTFMARHPMVD
EDKITLYGYSFSAMTALVAAGLDHRVGAAISVTPIANYDFREKEKNNVMA
LAMQDRVSTIAGNDPVYIPFVGDDGYNPAGWGNQYNMEQFRAFLGTSFFT
NQTTVQSYYHVLAWQPYGAMRLIKGTPVMMVTPAEDTISSPADQRAVFDI
IPEPKKEFDLVAGRGHMDVINGEGAEEVLQRQLDFMKKYLDF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDREDVEFPTFDGLTLRGWLCPGTIRGPAIVMNQGFNTPKEILLPDVALW
FQQQGVTVLLYDNRCIGASDGEPRNDVKPAKLVEDFHDALTFMARHPMVD
EDKITLYGYSFSAMTALVAAGLDHRVGAAISVTPIANYDFREKEKNNVMA
LAMQDRVSTIAGNDPVYIPFVGDDGYNPAGWGNQYNMEQFRAFLGTSFFT
NQTTVQSYYHVLAWQPYGAMRLIKGTPVMMVTPAEDTISSPADQRAVFDI
IPEPKKEFDLVAGRGHMDVINGEGAEEVLQRQLDFMKKYLDF

no DNA




References
    Title: Penicillium arizonense, a new, genome sequenced fungal species, reveals a high chemical diversity in secreted metabolites
    Grijseels S, Nielsen JC, Randelovic M, Nielsen J, Nielsen KF, Workman M, Frisvad JC
    Ref: Sci Rep, 6:35112, 2016 : PubMed

            

    Title: Draft Genome Sequence of the Pathogenic Filamentous Fungus Aspergillus udagawae Strain IFM 46973T
    Kusuya Y, Takahashi-Nakaguchi A, Takahashi H, Yaguchi T
    Ref: Genome Announc, 3:e00834, 2015 : PubMed

            

    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer