Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-64C2.070

Neurospora crassa hypothetical protein 64c2.070

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BX294009
1 UniProt : Q872K6
1 Interpro : Q872K6
1 Pfam : Q872K6
1 PIRSF : Q872K6
1 SUPERFAM : Q872K6
Sequence
Graphical view for this peptide sequence: neucr-64C2.070
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MASFSTAQDLFIPLGKDGQRMSYRLLGPSPSSSGKIPLVMLMGFRGTMDQ
WDPALIDPLAAQRPVILTDIPGVGRSEGAVPLSITEWAQSVVDLLIVMRI
PQVDVFGYSMGGCNAQMVALIAEEYSGGKVKVRRLVLAGTTPSDGQGVKR
FKREELEAFQRLAAAQTVEQQKEAFMKGFFGRCSEKSWAEGKKSWKRIAG
ARKKTMGQLGKEGSRRQGIAFAKFMGEGSLEKLKGLKMPVLIANGCQDLL
LPTENSYLMYKTLPNAYLHLYPDSGHGFLYQYADHFSSLVNLFLDGEKLG
ATLTPSKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASFSTAQDLFIPLGKDGQRMSYRLLGPSPSSSGKIPLVMLMGFRGTMDQ
WDPALIDPLAAQRPVILTDIPGVGRSEGAVPLSITEWAQSVVDLLIVMRI
PQVDVFGYSMGGCNAQMVALIAEEYSGGKVKVRRLVLAGTTPSDGQGVKR
FKREELEAFQRLAAAQTVEQQKEAFMKGFFGRCSEKSWAEGKKSWKRIAG
ARKKTMGQLGKEGSRRQGIAFAKFMGEGSLEKLKGLKMPVLIANGCQDLL
LPTENSYLMYKTLPNAYLHLYPDSGHGFLYQYADHFSSLVNLFLDGEKLG
ATLTPSKL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer