Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-faeb

Neurospora crassa (faeb) Feruloyl esterase B NcFae1

Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ293029
1 UniProt : Q9HGR3
1 UniProt : Q9HGR3
1 Interpro : Q9HGR3
1 Pfam : Q9HGR3
1 PIRSF : Q9HGR3
1 SUPERFAM : Q9HGR3
Sequence
Graphical view for this peptide sequence: neucr-faeb
Colored MSA for Esterase_phb (raw)
MLPRTLLGLALTAATGLCASLQQVTNWGSNPTNIRMHTYVPDKLATKPAI
IVALHGCGGTAPSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPAS
LTHGAGGDSLGIVAMVNYTIAKYNADASRVYVMGTSSGGMMTNVMAATYP
EVFEAGAAYSGVAHACFAGAASATPFSPNQTCARGLQHTPEEWGNFVRNS
YPGYTGRRPRMQICHGLADNLVYPRCAMEALKQWSNVLGVEFSRNVSGVP
SQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPRTLLGLALTAATGLCASLQQVTNWGSNPTNIRMHTYVPDKLATKPAI
IVALHGCGGTAPSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPAS
LTHGAGGDSLGIVAMVNYTIAKYNADASRVYVMGTSSGGMMTNVMAATYP
EVFEAGAAYSGVAHACFAGAASATPFSPNQTCARGLQHTPEEWGNFVRNS
YPGYTGRRPRMQICHGLADNLVYPRCAMEALKQWSNVLGVEFSRNVSGVP
SQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN


References
    Title: Fungal feruloyl esterases can catalyze release of diferulic acids from complex arabinoxylan
    Lin S, Hunt CJ, Holck J, Brask J, Krogh K, Meyer AS, Wilkens C, Agger JW
    Ref: Int J Biol Macromol, :123365, 2023 : PubMed

            

    Title: Expression of an alkaline feruloyl esterases from thermophilic Chaetomium thermophilum and its boosting effect on delignification of pulp
    Hou Y, Yang Z, Yin Y, Meng Z, Wang J, Zhao T, Yang Q
    Ref: Enzyme Microb Technol, 150:109859, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer