Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nicta-SABP2

Nicotiana tabacum (Common tobacco) salicylic acid-binding protein 2 mRNA, complete

Comment
this enzyme is close to Rubber tree hydroxynitrile lyase HbHNL. Few mutations can convert one activity to the other (Padhi et al. Nedrud et al.)


Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Nicotiana tabacum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Nicotianoideae: N E > Nicotianeae: N E > Nicotiana: N E > Nicotiana tabacum: N E


Molecular evidence
Database
No mutation
3 structures: 1XKL, 1Y7H, 1Y7I
No kinetic





1 substrate:
Methyl-salicylate
1 inhbitor:
Salicylic-acid
2 Genbank : AY485932, AAR87711
1 UniProt : Q6RYA0
1 Ncbi-nid : 40549302
1 Ncbi-pid : 40549303
3 Structure : 1XKL, 1Y7H, 1Y7I
1 UniProt : Q6RYA0
1 Interpro : Q6RYA0
1 Prodom : Q6RYA0
1 Pfam : Q6RYA0
1 PIRSF : Q6RYA0
1 SUPERFAM : Q6RYA0
Sequence
Graphical view for this peptide sequence: nicta-SABP2
Colored MSA for Hydroxynitrile_lyase (raw)
MKEGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIE
ELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYA
AVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMF
FGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSV
KRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCA
SLLEIAHKYN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIE
ELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYA
AVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMF
FGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSV
KRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCA
SLLEIAHKYN


References
4 more
    Title: Tobacco SABP2-interacting protein SIP428 is a SIR2 type deacetylase
    Haq MI, Thakuri BKC, Hobbs T, Davenport ML, Kumar D
    Ref: Plant Physiol Biochem, 152:72, 2020 : PubMed

            

    Title: Switching from an esterase to a hydroxynitrile lyase mechanism requires only two amino acid substitutions
    Padhi SK, Fujii R, Legatt GA, Fossum SL, Berchtold R, Kazlauskas RJ
    Ref: Chemical Biology, 17:863, 2010 : PubMed

            

    Title: High-affinity salicylic acid-binding protein 2 is required for plant innate immunity and has salicylic acid-stimulated lipase activity
    Kumar D, Klessig DF
    Ref: Proc Natl Acad Sci U S A, 100:16101, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer