Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nillu-b8q962

Nilaparvata lugens (Brown planthopper) Juvenile hormone esterase

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Nilaparvata lugens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Auchenorrhyncha: N E > Fulgoromorpha: N E > Fulgoroidea: N E > Delphacidae: N E > Delphacinae: N E > Nilaparvata: N E > Nilaparvata lugens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU380769
1 UniProt : B8Q962
1 UniProt : B8Q962
1 Interpro : B8Q962
1 Prodom : B8Q962
1 Pfam : B8Q962
1 PIRSF : B8Q962
1 SUPERFAM : B8Q962
Sequence
Graphical view for this peptide sequence: nillu-b8q962
Colored MSA for Carb_B_Arthropoda (raw)
MWCVVAVTLVLLVLVAQVYGLGKFKDLDLDDVINAKTVIRSGIVYGNIFK
FVGDDIFQAWTDIPYAKPPTGDQRYREADSEVTWSEPRNVTAKKPERCLQ
YNFISDKYNRVEGTEEACLMLSIYRYLGMVRPRLGPVIVLLHPGTYMYDF
PFDPRRFAANLCCDFFVTVVVNYRLAHTGFLSMHKNGVKANLGLLDQVAA
LKWVQRNIEAFYGDSNMVSLVGQSAGAAAVQLHLLSSMSRGLFRSAVSYS
GSALVPWAIGGDVGKKSLNFVRHNLNCTSLAITEIAECLRSISLNALFKE
VTGRFNHPLFHDFQNMPLSPLGPVVDNNFLDDDPLILLRAGAVTQMPYLF
SFTDSEGILPAAHLFEKEVPETRVENEWNTLAPTILDYNYTMHHLLHEKF
AERARKFYYPDYENGTKPPLFDNYGRFIKMLTDRLYTTGIVEGARLQGVA
TKNDSVYLYRYSYQGEFSFSDQIFGSRQLFGPAHADDFMTYIANQFPVRN
FADRVQKQMLTHIFLGFIEFGWADLPQGHTINDTFGLHFLVPMATTKQYF
KGASHPQQKRNARGSRIVSYNHLPPSHLVAGSKKHESYT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWCVVAVTLVLLVLVAQVYGLGKFKDLDLDDVINAKTVIRSGIVYGNIFK
FVGDDIFQAWTDIPYAKPPTGDQRYREADSEVTWSEPRNVTAKKPERCLQ
YNFISDKYNRVEGTEEACLMLSIYRYLGMVRPRLGPVIVLLHPGTYMYDF
PFDPRRFAANLCCDFFVTVVVNYRLAHTGFLSMHKNGVKANLGLLDQVAA
LKWVQRNIEAFYGDSNMVSLVGQSAGAAAVQLHLLSSMSRGLFRSAVSYS
GSALVPWAIGGDVGKKSLNFVRHNLNCTSLAITEIAECLRSISLNALFKE
VTGRFNHPLFHDFQNMPLSPLGPVVDNNFLDDDPLILLRAGAVTQMPYLF
SFTDSEGILPAAHLFEKEVPETRVENEWNTLAPTILDYNYTMHHLLHEKF
AERARKFYYPDYENGTKPPLFDNYGRFIKMLTDRLYTTGIVEGARLQGVA
TKNDSVYLYRYSYQGEFSFSDQIFGSRQLFGPAHADDFMTYIANQFPVRN
FADRVQKQMLTHIFLGFIEFGWADLPQGHTINDTFGLHFLVPMATTKQYF
KGASHPQQKRNARGSRIVSYNHLPPSHLVAGSKKHESYT


Reference
    Title: Molecular cloning and characterization of a juvenile hormone esterase gene from brown planthopper, Nilaparvata lugens
    Liu S, Yang B, Gu J, Yao X, Zhang Y, Song F, Liu Z
    Ref: J Insect Physiol, 54:1495, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer