Gene_locus Report for: nomle-g1r3w4Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Lipase H Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hylobatidae: N E > Nomascus: N E > Nomascus leucogenys: N E
ABHD6-Lip : nomle-g1r6t5Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. ABHD8 : nomle-g1r168Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Abhydrolase domain containing 8. ABHD10 : nomle-a0a2i3gyd4Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Abhydrolase domain containing 10. ABHD11-Acetyl_transferase : nomle-a0a2i3hff7Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). AB hydrolase-1 domain-containing protein. ABHD12-PHARC : nomle-g1rnx1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. ABHD13-BEM46 : nomle-a0a2i3gyc7Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Hydrolase_4 domain-containing protein. ABHD16 : nomle-g1r2z5Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Abhydrolase domain containing 16A, nomle-g1sbw8Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Abhydrolase domain containing 16B. abh_upf0017 : nomle-g1qt38Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Hydrolase_4 domain-containing protein. ACHE : nomle-g1rmy6Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. Arb2_FAM172A : nomle-g1ruh3Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Uncharacterized protein. Arylacetamide_deacetylase : nomle-g1rfj1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Uncharacterized protein. BCHE : nomle-g1qy42Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. Carb_B_Chordata : nomle-g1qm39Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1qmj9Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1qvw2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1qvy9Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-m3zas4Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobate Uncharacterized protein. Cholesterol_esterase : nomle-g1rrc2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. CIB-CCG1-interacting-factor-B : nomle-g1r5y6Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Uncharacterized protein. CMBL : nomle-g1rlj6Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Carboxymethylenebutenolidase homolog. Hepatic_Lipase : nomle-g1rks1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Lipase C, hepatic type. Lipoprotein_Lipase : nomle-g1qt41Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Lipoprotein lipase, nomle-g1rlf6Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Lipase G, endothelial type. Maspardin-ACP33-SPG21_like : nomle-g1rpx1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. Ndr_family : nomle-g1rvq8Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1r2m5Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1r1m0Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. Neuroligin : nomle-g1qkm3Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Neuroligin3, nomle-g1rb76Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Neuroligin, nomle-g1re28Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. NLS3-Tex30 : nomle-g1r8c7Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein, nomle-g1r8m7Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein. Pancreatic_lipase : nomle-g1s321Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Pancreatic lipase, nomle-g1s348Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Pancreatic lipase, nomle-g1s367Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Pancreatic lipase, nomle-g1s3b2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Pancreatic lipase. Phospholipase : nomle-a0a2i3hj53Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Phospholipase A1 member A, nomle-g1qma2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys). Lipase I. Thyroglobulin : nomle-g1r1g0Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobate leucogenys) Uncharacterized protein. Valacyclovir-hydrolase : nomle-g1rjt9Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) Uncharacterized protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: nomle-g1r3w4 Colored MSA for Phospholipase (raw)
MLRFYLFISLMCLARSDTEETCPSFTRLSFHSAVVGTGLNVRLLLYTRRN
LTCAQTINSSAFGNLNVTKKTTFVVHGFRPTGSPPVWLDDLVKGLLSVED
MNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIYM
IGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQF
VDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQR
SVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGASQKESCPLLGYYAD
NWKDYLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNIRRGDITIK
LRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGS
LTGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ
L
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLRFYLFISLMCLARSDTEETCPSFTRLSFHSAVVGTGLNVRLLLYTRRN LTCAQTINSSAFGNLNVTKKTTFVVHGFRPTGSPPVWLDDLVKGLLSVED MNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIYM IGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQF VDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQR SVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGASQKESCPLLGYYAD NWKDYLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNIRRGDITIK LRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGS LTGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ L
|
|
|