Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: octbm-a0a0l8gh87

Octopus bimaculoides (California two-spotted octopus) Uncharacterized protein

Comment
California two-spotted octopus


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Octopus bimaculoides
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Cephalopoda: N E > Coleoidea: N E > Neocoleoidea: N E > Octopodiformes: N E > Octopoda: N E > Incirrata: N E > Octopodidae: N E > Octopus: N E > Octopus bimaculoides: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_014781043.1
1 UniProt : A0A0L8GH87
1 Interpro : A0A0L8GH87
1 Pfam : A0A0L8GH87
1 PIRSF : A0A0L8GH87
1 SUPERFAM : A0A0L8GH87
Sequence
Graphical view for this peptide sequence: octbm-a0a0l8gh87
Colored MSA for ACHE (raw)
MEGMKYILIISLLKTFVHAEDQIIDTTTGKINGSTVLVQNVKLDVFLGIP
FAKPPVGNLRFRRPEQIERWSGIKETKEHVSACAQFEDNTFNDVPGADLW
KIKANISEDCLYLNIWTPTEARKSRSNLTTMIWIYGGGFIFGSSTLGIYD
GKWLAVSQNIIVASFNYRLGPFGFLSLNDERAPGNMGLLDQNLAIKWIHD
NIASFGGDPDKLTLFGESAGAVSVSMHVISPMSRNLFRNAIIMSGTSNAD
WAIKTKEENINRAKEMAAFLRCPTENDEQMLNCFLNAKTEKLSLGQLHNL
KGFFGIPFAPIIDNYFLQAKPNKALQSKAIKKDVLIGFVKNEGSLFLLSG
FPKYFTTNKTVPINNSLAHKLIKEVIEPAQVNSVQLDSIFYVYGSNVYSS
SETEKYRYVLDQVAGDTIFKCPAINFSREWSTHSNVYMYSFEYRSNDSPW
PEWMGTIHGNDIYYVFSQVLYGQNYSSEDKGVSEMMSSYFANFSKSSNPN
NGDCADCSNEPWSKFTPKNQKYFVIDKKTKMENKDTSMYNVCGFWSDLLP
ELKERSCPVPSGSQNIWTFQGRILTTFSFIFFSLMLFWNILC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGMKYILIISLLKTFVHAEDQIIDTTTGKINGSTVLVQNVKLDVFLGIP
FAKPPVGNLRFRRPEQIERWSGIKETKEHVSACAQFEDNTFNDVPGADLW
KIKANISEDCLYLNIWTPTEARKSRSNLTTMIWIYGGGFIFGSSTLGIYD
GKWLAVSQNIIVASFNYRLGPFGFLSLNDERAPGNMGLLDQNLAIKWIHD
NIASFGGDPDKLTLFGESAGAVSVSMHVISPMSRNLFRNAIIMSGTSNAD
WAIKTKEENINRAKEMAAFLRCPTENDEQMLNCFLNAKTEKLSLGQLHNL
KGFFGIPFAPIIDNYFLQAKPNKALQSKAIKKDVLIGFVKNEGSLFLLSG
FPKYFTTNKTVPINNSLAHKLIKEVIEPAQVNSVQLDSIFYVYGSNVYSS
SETEKYRYVLDQVAGDTIFKCPAINFSREWSTHSNVYMYSFEYRSNDSPW
PEWMGTIHGNDIYYVFSQVLYGQNYSSEDKGVSEMMSSYFANFSKSSNPN
NGDCADCSNEPWSKFTPKNQKYFVIDKKTKMENKDTSMYNVCGFWSDLLP
ELKERSCPVPSGSQNIWTFQGRILTTFSFIFFSLMLFWNILC



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer