Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: opitp-b1zmf4

Opitutus terrae (strain DSM 11246 / PB90-1) OtCE15A Glucuronoyl Esterase

Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|Opitutus terrae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > Opitutus: N E > Opitutus terrae: N E


Molecular evidence
Database
No mutation
11 structures (e.g. : 6GRW, 6GS0, 6SYR... more)
No kinetic





No Substrate
9 inhibitors (e.g. : 4-O-Methyl-alpha-D-glucuronate, Aldotetrauronic-acid, Benzyl-D-glucuronoate... more)
2 Genbank : ACB73407, WP_012372945
1 UniProt : B1ZMF4
>3 Structure links 8 more: 6SYR, 6SZO, 6SYV
1 UniProt : B1ZMF4
1 Interpro : B1ZMF4
1 Prodom : B1ZMF4
1 Pfam : B1ZMF4
1 PIRSF : B1ZMF4
1 SUPERFAM : B1ZMF4
Sequence
Graphical view for this peptide sequence: opitp-b1zmf4
Colored MSA for Glucuronoyl_esterase (raw)
MRNVLAALSLLFTLTSMQATSRPARLDDTPPPAYTLPDPLVGADGTRVHD
RATWQHRRRPELLQLFAREVYGRTPLGRPEGMVFKVTTMEHAALGGAATR
KEVTVRFGRDPNAPSMQLLLYVPNAVIARAERAPVFLGLNFYGNHTVHTD
PAIALSARWIPAEAPNGANHRATEAARGSDAQKWPVEQILARGYAVATVY
CGDLCPDRPDGLNASVASWLDAAAGDQRAPDAWGAIGVWAWGLSRALDYL
ETDPLVDASRVAVHGHSRLGKAALWAGAQDDRFALVISNESGCGGAALSK
RIHGETVARINTVFPHWFARNFRRYDDHEEALPVDQHELLALVAPRPLYV
ASAEDDDWADPRGEFLAVKAAEPVFRLFGQTGPSGEDVPRVNEPSGGALR
YHIRPGPHGMTAQDWAFYLAFADEWLKSALPAREPQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRNVLAALSLLFTLTSMQATSRPARLDDTPPPAYTLPDPLVGADGTRVHD
RATWQHRRRPELLQLFAREVYGRTPLGRPEGMVFKVTTMEHAALGGAATR
KEVTVRFGRDPNAPSMQLLLYVPNAVIARAERAPVFLGLNFYGNHTVHTD
PAIALSARWIPAEAPNGANHRATEAARGSDAQKWPVEQILARGYAVATVY
CGDLCPDRPDGLNASVASWLDAAAGDQRAPDAWGAIGVWAWGLSRALDYL
ETDPLVDASRVAVHGHSRLGKAALWAGAQDDRFALVISNESGCGGAALSK
RIHGETVARINTVFPHWFARNFRRYDDHEEALPVDQHELLALVAPRPLYV
ASAEDDDWADPRGEFLAVKAAEPVFRLFGQTGPSGEDVPRVNEPSGGALR
YHIRPGPHGMTAQDWAFYLAFADEWLKSALPAREPQR


References
    Title: Mechanism and biomass association of glucuronoyl esterase: an alpha/beta hydrolase with potential in biomass conversion
    Zong Z, Mazurkewich S, Pereira CS, Fu H, Cai W, Shao X, Skaf MS, Larsbrink J, Lo Leggio L
    Ref: Nat Commun, 13:1449, 2022 : PubMed

            

    Title: Structural and biochemical studies of the glucuronoyl esterase OtCE15A illuminate its interaction with lignocellulosic components
    Mazurkewich S, Poulsen JN, Lo Leggio L, Larsbrink J
    Ref: Journal of Biological Chemistry, 294:19978, 2019 : PubMed

            

    Title: Biochemical and structural features of diverse bacterial glucuronoyl esterases facilitating recalcitrant biomass conversion
    Arnling Baath J, Mazurkewich S, Knudsen RM, Poulsen JN, Olsson L, Lo Leggio L, Larsbrink J
    Ref: Biotechnol Biofuels, 11:213, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer