Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orcvi-ACHE2

Orchesella villosa acetylcholinesterase 2 (ace2)

Comment
long n-term sequence not included 1-134


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Orchesella villosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Collembola [class]: N E > Collembola [order]: N E > Entomobryomorpha: N E > Entomobryoidea: N E > Entomobryidae: N E > Orchesellinae: N E > Orchesella: N E > Orchesella villosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FJ228228
1 UniProt : B8XCX2
1 Ncbi-nid : 219553195
1 Ncbi-pid : 219553196
1 UniProt : B8XCX2
1 Interpro : B8XCX2
1 Prodom : B8XCX2
1 Pfam : B8XCX2
1 PIRSF : B8XCX2
1 SUPERFAM : B8XCX2
Sequence
Graphical view for this peptide sequence: orcvi-ACHE2
Colored MSA for ACHE (raw)
TPKGTFIGLKKTINATDVYAFYAIPFAKPPVGNLRFRRPEAADKLTEPYD
ATHLPNACSQPVSDVFGDFPGEKVWYPNTNISEDCLYVNIWVPAKVFEKK
EEELEPVIFWIYGGGYFSGSASLDVYDGAVIAATQGLVVVSPQYRLGPFG
FLYLGVEDAPGNMGLIDQTLALKWTRENIEYFGGDPNAVTAAGESCGSAS
VGFHLVSPLSKSYFKRGIMTSGLPTAKYAFKSPDEAKSRSFQFAKHAGCK
SKNPKEIIECLRDVDAETLTHLQWKVYKGLLDFPFSPTVDGYFLTDHPDN
VLKKGNAKRAELVLGTVRDEGTYFIIYHYLNYFSNTKPTSVPYDRFVDIL
NEIFQDYSETEREAIIDEYTNWENPEDGHANQRLIGEAVGDAIFVCPHRK
FADDWANRGLSVYYYHFTERFSNNPWAKWMGVMHGDDIPLFFGDAVTETS
YSDGEKQMTQKFMSMVANFARMGIPSTKWERYTSEHPMYLEVNATVVTDA
STHDQHGPRAEKCAFWNKFLPLLRSASEQCNNSPQSQSQQFGSLRQPQQQ
PQWNANGQGIHGGQGFQSDNLHNNEVQYQFIPNPTHQPHCGPPSPHMPMY
FSPPPNYYPPPQFHSQQYNGCGAPLAAPSPTAQSCQCTVQETSTTSAGQE
VDDFRTPRPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

TPKGTFIGLKKTINATDVYAFYAIPFAKPPVGNLRFRRPEAADKLTEPYD
ATHLPNACSQPVSDVFGDFPGEKVWYPNTNISEDCLYVNIWVPAKVFEKK
EEELEPVIFWIYGGGYFSGSASLDVYDGAVIAATQGLVVVSPQYRLGPFG
FLYLGVEDAPGNMGLIDQTLALKWTRENIEYFGGDPNAVTAAGESCGSAS
VGFHLVSPLSKSYFKRGIMTSGLPTAKYAFKSPDEAKSRSFQFAKHAGCK
SKNPKEIIECLRDVDAETLTHLQWKVYKGLLDFPFSPTVDGYFLTDHPDN
VLKKGNAKRAELVLGTVRDEGTYFIIYHYLNYFSNTKPTSVPYDRFVDIL
NEIFQDYSETEREAIIDEYTNWENPEDGHANQRLIGEAVGDAIFVCPHRK
FADDWANRGLSVYYYHFTERFSNNPWAKWMGVMHGDDIPLFFGDAVTETS
YSDGEKQMTQKFMSMVANFARMGIPSTKWERYTSEHPMYLEVNATVVTDA
STHDQHGPRAEKCAFWNKFLPLLRSASEQCNNSPQSQSQQFGSLRQPQQQ
PQWNANGQGIHGGQGFQSDNLHNNEVQYQFIPNPTHQPHCGPPSPHMPMY
FSPPPNYYPPPQFHSQQYNGCGAPLAAPSPTAQSCQCTVQETSTTSAGQE
VDDFRTPRPE


Reference
    Title: Acetylcholinesterase genes in the basal Hexapod Orchesella villosa
    Nardi F, Barazzuoli B, Ciolfi S, Carapelli A, Dallai R, Frati F
    Ref: Insect Molecular Biology, 18:45, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer