Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q5N7L1

Oryza sativa subsp. indica subsp. japonica (Rice) p0519d04.28 protein

Comment
obsolete Q8S9W5 P0519D04.21


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AP003455, AP008207, CM000138
>3 UniProt links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 UniProt links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 Interpro links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 Prodom links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 Pfam links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 PIRSF links 1 more: Q5N7L1, Q0JK96, A2ZWP5
>3 SUPERFAM links 1 more: Q5N7L1, Q0JK96, A2ZWP5
Sequence
Graphical view for this peptide sequence: orysa-Q5N7L1
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MAAILQPPRHAAVVAPRRAGRLARPGCAGGRRAAVAVEAAVGAARDRKPP
RLEGASEELRAAAAQCLDWAPARRRVRGAFAPVLPTLDHCLFKMAPKGIQ
MEENFETNSKGVEIFWKSWLPREGTATKAALFFCHGYGDTCTFFFEGIAK
RIAAAGYAVYAMDYPGFGLSYGLHGYIASFDGMVEHVIEQYSRIKGRKEV
RGLPHFLLGQSMGGAVALKVHLKQPKEWDGVLLVAPMCKISEDVTPPAPV
LKALSILSCLLPEAKLFPQKDIGDLAFRDPSKRKVAEYNAISYTQQMRLR
TAVELLKATKDIESQLEKICSPLLILHGAADLVTDPHVSEFLYEKASTKD
KTLKLYEDGYHSILEGEPDDRISTAINDIISWLDSHC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAILQPPRHAAVVAPRRAGRLARPGCAGGRRAAVAVEAAVGAARDRKPP
RLEGASEELRAAAAQCLDWAPARRRVRGAFAPVLPTLDHCLFKMAPKGIQ
MEENFETNSKGVEIFWKSWLPREGTATKAALFFCHGYGDTCTFFFEGIAK
RIAAAGYAVYAMDYPGFGLSYGLHGYIASFDGMVEHVIEQYSRIKGRKEV
RGLPHFLLGQSMGGAVALKVHLKQPKEWDGVLLVAPMCKISEDVTPPAPV
LKALSILSCLLPEAKLFPQKDIGDLAFRDPSKRKVAEYNAISYTQQMRLR
TAVELLKATKDIESQLEKICSPLLILHGAADLVTDPHVSEFLYEKASTKD
KTLKLYEDGYHSILEGEPDDRISTAINDIISWLDSHC


References
3 more
    Title: The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information
    Ohyanagi H, Tanaka T, Sakai H, Shigemoto Y, Yamaguchi K, Habara T, Fujii Y, Antonio BA, Nagamura Y and Sasaki T <4 more author(s)>
    Ref: Nucleic Acids Research, 34:D741, 2006 : PubMed

            

    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            

    Title: The genome sequence and structure of rice chromosome 1
    Sasaki T, Matsumoto T, Yamamoto K, Sakata K, Baba T, Katayose Y, Wu J, Niimura Y, Cheng Z and Gojobori T <69 more author(s)>
    Ref: Nature, 420:312, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer