Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q5ZA26

Oryza sativa subsp. japonica subsp. indica (Rice) putative serine carboxypeptidase II-like protein

Comment
Oryza sativa subsp. japonica subsp. indica (Rice) Oryza glaberrima (African rice)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP003537
3 UniProt : Q5ZA26, B8A7F8, I1NMT1
3 UniProt : Q5ZA26, B8A7F8, I1NMT1
3 Interpro : Q5ZA26, B8A7F8, I1NMT1
3 Pfam : Q5ZA26, B8A7F8, I1NMT1
3 PIRSF : Q5ZA26, B8A7F8, I1NMT1
3 SUPERFAM : Q5ZA26, B8A7F8, I1NMT1
Sequence
Graphical view for this peptide sequence: orysa-Q5ZA26
Colored MSA for Carboxypeptidase_S10 (raw)
MATEAAATARCLLLPLLSPLQSPHKQQQLIFAALLLLFFFSSLQSLHCYA
AAGYNEQQEADRVAFLPGQPSSPKVSQFSGYITVNRQNGRALFYWFFEAQ
ALPSQKPLLLWLNGGPGCSSVGYGAASELGPLRVSRNGAGLEFNKFAWNK
EANLLFLESPVGVGFSYTNTSSDLTKLNDGFVAEDAYNFLVNWLDRFPQY
KDHEFYISGESYAGHYVPQLADLVYERNKDKKANRYIKLKGFIVGNPLTD
DQYDSKGLVEYAWSHAVVSDGIYERVKKVCNFKISNWTNDCNEAMSSIFR
QYQEIDIYNIYAPKCNLAQTSRVAAFDHALEASDQEQFSRRIRMFSGYDA
CYSSYAEKYFNKPDVQKAFHANANGMLPGKWKVCSDSILRSYNFSVLSVL
PIYSKLIKAGLRIWLYSGDADGRVPVIGSRYCVEALGLHIKRDWQPWYLN
RQVAGRFVEYDGMTMVTIRGAGHLVPLNKPEEGLTLIDTFLLGKQLLTHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATEAAATARCLLLPLLSPLQSPHKQQQLIFAALLLLFFFSSLQSLHCYA
AAGYNEQQEADRVAFLPGQPSSPKVSQFSGYITVNRQNGRALFYWFFEAQ
ALPSQKPLLLWLNGGPGCSSVGYGAASELGPLRVSRNGAGLEFNKFAWNK
EANLLFLESPVGVGFSYTNTSSDLTKLNDGFVAEDAYNFLVNWLDRFPQY
KDHEFYISGESYAGHYVPQLADLVYERNKDKKANRYIKLKGFIVGNPLTD
DQYDSKGLVEYAWSHAVVSDGIYERVKKVCNFKISNWTNDCNEAMSSIFR
QYQEIDIYNIYAPKCNLAQTSRVAAFDHALEASDQEQFSRRIRMFSGYDA
CYSSYAEKYFNKPDVQKAFHANANGMLPGKWKVCSDSILRSYNFSVLSVL
PIYSKLIKAGLRIWLYSGDADGRVPVIGSRYCVEALGLHIKRDWQPWYLN
RQVAGRFVEYDGMTMVTIRGAGHLVPLNKPEEGLTLIDTFLLGKQLLTHR


References
1 more
    Title: Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana
    Itoh T, Tanaka T, Barrero RA, Yamasaki C, Fujii Y, Hilton PB, Antonio BA, Aono H, Apweiler R and Sasaki T <85 more author(s)>
    Ref: Genome Res, 17:175, 2007 : PubMed

            

    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            

    Title: The genome sequence and structure of rice chromosome 1
    Sasaki T, Matsumoto T, Yamamoto K, Sakata K, Baba T, Katayose Y, Wu J, Niimura Y, Cheng Z and Gojobori T <69 more author(s)>
    Ref: Nature, 420:312, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer