Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q8GSE8

Oryza sativa (subsp. indica subsp. japonica) (Rice); Oryza glaberrima (African rice); Oryza glumipatula 1714H10.48 chr7 hypothetical protein

Comment
Other strains: Oryza sativa (subsp. indica subsp. japonica) (Rice); Oryza glaberrima (African rice); Oryza glumipatula


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP003847, AP004664
>3 UniProt links 2 more: A2YIF3, B9FVM3, Q8GSE8
1 Ncbi-nid : 22831069
1 Ncbi-pid : 22831103
>3 UniProt links 2 more: Q8GSE8, A2YIF3, B9FVM3
>3 Interpro links 2 more: Q8GSE8, A2YIF3, B9FVM3
>3 Pfam links 2 more: Q8GSE8, A2YIF3, B9FVM3
>3 PIRSF links 2 more: Q8GSE8, A2YIF3, B9FVM3
>3 SUPERFAM links 2 more: Q8GSE8, A2YIF3, B9FVM3
Sequence
Graphical view for this peptide sequence: orysa-Q8GSE8
Colored MSA for Plant_carboxylesterase (raw)
MASLSDPNSPPPHVVEDCRGALQLLSDGTVVRAAAPPPPFYVRLDIDDGR
VEWKDVVYDAAHGLGVRMYRPAATGGAEEKLPVVVYFHGGGFCIGSCTWP
NFHAGCLRLAAELPAVVLSFDYRLAPEHRLPAAHEDAAAALIWLRDQLLS
DPWLADAADARKVFVSGESAGGNFAHHLAVRFGAAGLDPVRVAGYVLLMP
AFISERPTPSELAAPATAFLTRDMCDRYCRLALPAGADKDHPLVNPFGPA
SRSLEAVDVGRVLVVAADGDLLRDKNVEYAERMKAMGKDVELVVFAGEEH
AFFGVKPMSAATGELVEVIRRFIAGAAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASLSDPNSPPPHVVEDCRGALQLLSDGTVVRAAAPPPPFYVRLDIDDGR
VEWKDVVYDAAHGLGVRMYRPAATGGAEEKLPVVVYFHGGGFCIGSCTWP
NFHAGCLRLAAELPAVVLSFDYRLAPEHRLPAAHEDAAAALIWLRDQLLS
DPWLADAADARKVFVSGESAGGNFAHHLAVRFGAAGLDPVRVAGYVLLMP
AFISERPTPSELAAPATAFLTRDMCDRYCRLALPAGADKDHPLVNPFGPA
SRSLEAVDVGRVLVVAADGDLLRDKNVEYAERMKAMGKDVELVVFAGEEH
AFFGVKPMSAATGELVEVIRRFIAGAAA


References
2 more
    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice
    Kikuchi S, Satoh K, Nagata T, Kawagashira N, Doi K, Kishimoto N, Yazaki J, Ishikawa M, Yamada H and Yasunishi A <64 more author(s)>
    Ref: Science, 301:376, 2003 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer