Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-q33aq0

Oryza sativa (Rice) Oryza glaberrima; Oryza brachyantha. OsMas1 involved in salt and drought tolerance expressed protein.

Comment
OsMas1 involved in salt and drought tolerance. Other strains Oryza sativa (Rice) (japonica cultivar-group; subsp. indica) Oryza glaberrima (African rice;) Oryza brachyantha


Relationship
Family|Maspardin-ACP33-SPG21_like
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: orysa-q33aq0
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
MKGGGGAAAASAAPGDYVYFKSVVPLHKISIGPKLWRYYDFGPKTVPPLV
CIPGIAGTADVYYKQIMSLSMKGYRVMSIDVPQVWNHQEWIHSFEKFLDS
MNIHHVHIYGTSLGGFLAQIFAQHRPRRVKSLVLSNTFLETHKFAAATPW
SPVVNWTPSFLLKRYLLTGIRDGPHEPFIADSVDFVVSQVETLSRDDLSS
RLMLNVNVASVGSLMLPDSLITIMDTNDYSAVPQQLKDQVNERYPGARRA
VLKTGGDFPFLSRPDEVNLYLQLHLRRVGVEPRPDLVQGFTRNGSAGSSK
DQKDGGNNFDNHPGDNGGPGSGGHDHETQNSGSESHDSDESIPTSTMLAN
TILGTVSSTLQASLCVLLIHHYYESALYISSRQPLDV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKGGGGAAAASAAPGDYVYFKSVVPLHKISIGPKLWRYYDFGPKTVPPLV
CIPGIAGTADVYYKQIMSLSMKGYRVMSIDVPQVWNHQEWIHSFEKFLDS
MNIHHVHIYGTSLGGFLAQIFAQHRPRRVKSLVLSNTFLETHKFAAATPW
SPVVNWTPSFLLKRYLLTGIRDGPHEPFIADSVDFVVSQVETLSRDDLSS
RLMLNVNVASVGSLMLPDSLITIMDTNDYSAVPQQLKDQVNERYPGARRA
VLKTGGDFPFLSRPDEVNLYLQLHLRRVGVEPRPDLVQGFTRNGSAGSSK
DQKDGGNNFDNHPGDNGGPGSGGHDHETQNSGSESHDSDESIPTSTMLAN
TILGTVSSTLQASLCVLLIHHYYESALYISSRQPLDV


References
3 more
    Title: OsMas1, a novel maspardin protein gene, confers the tolerance to salt and drought stresses by regulating ABA signaling in rice
    Wang FB, Wan CZ, Niu HF, Qi MY, Li G, Zhang F, Hu LB, Ye YX, Wang ZX and Yuan CY <2 more author(s)>
    Ref: J.Integr.Agric, :, 2022 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: In-depth view of structure, activity, and evolution of rice chromosome 10.
    Yu Y
    Ref: Science, 300:1566, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer