Gene_Locus Report
Biblio print
Add to basket
Go to basket
Tree Display
AceDB Schema
XML Display
Feedback

Gene_locus Report for: orysa-q6l556

Oryza sativa (japonica cultivar-group) subsp. indica (Rice) Dwarf14-like2a Os05g0590300 D14L2a

Comment
Dwarf14-like2a gene localized in rice roots on infection of arbuscular mycorrhizal fungus and hydrolysis of rac-GR24 by the encoded protein (Sisaphaithong et al.). Also named STH1, it is an integration hub for salt tolerance and heading date. STH1 regulates hydrolytic degradation of fatty acid, which contributes to salt tolerance. STH1 forms a protein complex with D3 and a vital regulatory factor in salt tolerance, OsHAL3, to affect the protein abundance of OsHAL3 by ubiquitination pathway. STH1 serves as a co-activator of the floral integrator gene Heading date 1 (Hd1) to balance the expression of the florigen gene Heading date 3a (Hd3a) under different circumstances, thus coordinating the regulation of salt tolerance and heading date. The allele of STH1 associated with enhanced salt tolerance and high yield is partially found in African rice, but not in Asian cultivars


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
GR24
No inhibitor
>3 Genbank links 6 more: AC105260, AC136216, CM000130
2 UniProt : Q6L556, A2Y832
>3 UniProt links 1 more: Q6L556, B9FIT0, A2Y832
>3 Interpro links 1 more: Q6L556, B9FIT0, A2Y832
>3 Pfam links 1 more: Q6L556, B9FIT0, A2Y832
>3 PIRSF links 1 more: Q6L556, B9FIT0, A2Y832
>3 SUPERFAM links 1 more: Q6L556, B9FIT0, A2Y832
Sequence
Peptide
Graphical view for this peptide sequence: orysa-q6l556
Colored MSA for RsbQ-like (raw) 
MKKMWRANARVVERRGGREAEERGGVISVVLAHGYGASQAVWDKLVPSLS
KSHNLLLFDWDFTGAGAGKDDDEYTYGRFADELIAVMEERGVGASGAVVV
AHSMSAMAACIAAQRRPDLFAHIFLVCASPRYINLEEEGYVGGFEEAAIH
GMLAAMESDFDGWVRSFLPNAAGYASAVEHLLKSFLAMDPTVALKLAKMI
FLGDQREVLDGVKTPCTIVQVKADFAAPPSVAEYMHLRMKGAATAVEIIG
SVGHFPQLVAPQQLLDILAGVLRLREAAAEAEHDDAGTVEIAGGIDVAI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MKKMWRANARVVERRGGREAEERGGVISVVLAHGYGASQAVWDKLVPSLS
KSHNLLLFDWDFTGAGAGKDDDEYTYGRFADELIAVMEERGVGASGAVVV
AHSMSAMAACIAAQRRPDLFAHIFLVCASPRYINLEEEGYVGGFEEAAIH
GMLAAMESDFDGWVRSFLPNAAGYASAVEHLLKSFLAMDPTVALKLAKMI
FLGDQREVLDGVKTPCTIVQVKADFAAPPSVAEYMHLRMKGAATAVEIIG
SVGHFPQLVAPQQLLDILAGVLRLREAAAEAEHDDAGTVEIAGGIDVAI

References
    Title: An alpha/beta hydrolase family member negatively regulates salt tolerance but promotes flowering through three distinct functions in rice
    Xiang YH, Yu JJ, Liao B, Shan JX, Ye WW, Dong NQ, Guo T, Kan Y, Zhang H and Lin HX <5 more author(s)>
    Ref: Mol Plant, :, 2022 : PubMed

            

    Title: Localized expression of the Dwarf14-like2a gene in rice roots on infection of arbuscular mycorrhizal fungus and hydrolysis of rac-GR24 by the encoded protein
    Sisaphaithong T, Yanase M, Mano T, Tanabe S, Minami E, Tanaka A, Hata S, Kobae Y
    Ref: Plant Signal Behav, :2009998, 2021 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            


Other Papers

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer