Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysj-Q10QA5

Oryza sativa (japonica cultivar-group) High tillering - Dwarf Dwarf88/HTD2OsD14 Dwarf14 putative hydrolases. Dwarfism with High Tillering Ability 34 (dhta-34)

Comment
Other strains: Oryza sativa (japonica cultivar-group); Oryza glumipatula


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
13 structures (e.g. : 3VXK, 3W04, 3W05... more)
No kinetic





3 substrates: GR24, Yoshimulactone-Green, desmethyl-Yoshimulactone-Green
9 inhibitors (e.g. : 2-methoxy-1-naphthaldehyde, Hydroxy-D-ring, KK052... more)
1 Genbank : AK070827
2 UniProt : Q10QA5, A0A0D9Z3K8
1 Ncbi-pid : NP_001049306
>3 Structure links 10 more: 6ELX, 6AP8, 5DJ5
2 UniProt : Q10QA5, A0A0D9Z3K8
2 Interpro : Q10QA5, A0A0D9Z3K8
2 Prodom : Q10QA5, A0A0D9Z3K8
2 Pfam : Q10QA5, A0A0D9Z3K8
2 PIRSF : Q10QA5, A0A0D9Z3K8
2 SUPERFAM : Q10QA5, A0A0D9Z3K8
Sequence
Graphical view for this peptide sequence: orysj-Q10QA5
Colored MSA for RsbQ-like (raw)
MLRSTHPPPSSPSSSSSGGGGGGGSSASSSSEKTMVGGGGGGGGGSGSAA
PSGAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVL
YDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSA
MIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGA
NYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLR
GVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPH
LSAPSLLAQVLRRALARY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRSTHPPPSSPSSSSSGGGGGGGSSASSSSEKTMVGGGGGGGGGSGSAA
PSGAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVL
YDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSA
MIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGA
NYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLR
GVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPH
LSAPSLLAQVLRRALARY


References
10 more
    Title: Identification and Characterization of a Novel Strigolactone-Insensitive Mutant, Dwarfism with High Tillering Ability 34 (dhta-34) in Rice (Oryza sativa L.)
    Liang R, Qin R, Yang C, Zeng D, Jin X, Shi C
    Ref: Biochemical Genetics, 57:403, 2019 : PubMed

            

    Title: Structural plasticity of D3-D14 ubiquitin ligase in strigolactone signalling
    Shabek N, Ticchiarelli F, Mao H, Hinds TR, Leyser O, Zheng N
    Ref: Nature, 563:652, 2018 : PubMed

            

    Title: Dwarf 88, a novel putative esterase gene affecting architecture of rice plant
    Gao Z, Qian Q, Liu X, Yan M, Feng Q, Dong G, Liu J, Han B
    Ref: Plant Mol Biol, 71:265, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer