Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysj-b9fi05

Oryza sativa subsp. japonica subsp. indica (Rice) Os05g0179900 Putative uncharacterized protein

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Oryza sativa subsp. japonica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E > Oryza sativa Japonica Group: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CM000142, CM000130, AP008211
3 UniProt : B9FI05, B8AYN7, C7J2X4
3 UniProt : B9FI05, B8AYN7, C7J2X4
3 Interpro : B9FI05, B8AYN7, C7J2X4
3 Prodom : B9FI05, B8AYN7, C7J2X4
3 Pfam : B9FI05, B8AYN7, C7J2X4
3 PIRSF : B9FI05, B8AYN7, C7J2X4
3 SUPERFAM : B9FI05, B8AYN7, C7J2X4
Sequence
Graphical view for this peptide sequence: orysj-b9fi05
Colored MSA for RsbQ-like (raw)
MNARVLGGGGGGGGDGETTVVLAHGYGGSSHIWDDVAPALAKTFRVVVFD
WSFSGDFVVDDDDDAAAVSEDISCSYFGFADELVAMMDELALTAVVFVGH
SMAGMIGCIASVARPELFRHLVLVGASPRYINDDGDGYVGGFERGEVDAM
LAAIEADFAACAPLFAEAVVGPAPSPGAGAVAKFAKQLGRMRPAAALRVM
RAVLTCDVRAVLRDVAAPCTIVHCARDAVAPLAVARYMQRAMARGVDGAP
APAVVVMDSSGHFPQLTAPMEFVRVMEAILLDH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNARVLGGGGGGGGDGETTVVLAHGYGGSSHIWDDVAPALAKTFRVVVFD
WSFSGDFVVDDDDDAAAVSEDISCSYFGFADELVAMMDELALTAVVFVGH
SMAGMIGCIASVARPELFRHLVLVGASPRYINDDGDGYVGGFERGEVDAM
LAAIEADFAACAPLFAEAVVGPAPSPGAGAVAKFAKQLGRMRPAAALRVM
RAVLTCDVRAVLRDVAAPCTIVHCARDAVAPLAVARYMQRAMARGVDGAP
APAVVVMDSSGHFPQLTAPMEFVRVMEAILLDH


References
2 more
    Title: The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information
    Ohyanagi H, Tanaka T, Sakai H, Shigemoto Y, Yamaguchi K, Habara T, Fujii Y, Antonio BA, Nagamura Y and Sasaki T <4 more author(s)>
    Ref: Nucleic Acids Research, 34:D741, 2006 : PubMed

            

    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer