Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ostlu-a4s7a8

Ostreococcus lucimarinus (strain CCE9901) Predicted protein

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Ostreococcus lucimarinus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Chlorophyta: N E > prasinophytes: N E > Mamiellophyceae: N E > Mamiellales: N E > Bathycoccaceae: N E > Ostreococcus: N E > Ostreococcus 'lucimarinus': N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000594
1 UniProt : A4S7A8
1 UniProt : A4S7A8
1 Interpro : A4S7A8
1 Pfam : A4S7A8
1 PIRSF : A4S7A8
1 SUPERFAM : A4S7A8
Sequence
Graphical view for this peptide sequence: ostlu-a4s7a8
Colored MSA for A85-EsteraseD-FGH (raw)
MAPFNLKTISVTRAHHGTLHRLQHDSETLSSVATFAVFVPGAVEDFKDKF
PLLLYLSGLTCTDENVAQKGCAFEHCHARRVAMVMPDTSPRGDDAADDEA
WDLGKGAGFYVDASAAPWSRHYKTYSYVTKELPKVLRACDFADALDHERV
SISGHSMGGHGALTLALRNPNAYASASAFAPIANPTASDCPWGQKALKAY
LGSADCDEAKSHDATELVKSVEAGTFKMPILIDQGAADSFYKTQLHPERF
VDAAKERGCDVTYRLHDGYDHSYFFVSTFMREHIEFHAAALGSLKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPFNLKTISVTRAHHGTLHRLQHDSETLSSVATFAVFVPGAVEDFKDKF
PLLLYLSGLTCTDENVAQKGCAFEHCHARRVAMVMPDTSPRGDDAADDEA
WDLGKGAGFYVDASAAPWSRHYKTYSYVTKELPKVLRACDFADALDHERV
SISGHSMGGHGALTLALRNPNAYASASAFAPIANPTASDCPWGQKALKAY
LGSADCDEAKSHDATELVKSVEAGTFKMPILIDQGAADSFYKTQLHPERF
VDAAKERGCDVTYRLHDGYDHSYFFVSTFMREHIEFHAAALGSLKI


Reference
    Title: The tiny eukaryote Ostreococcus provides genomic insights into the paradox of plankton speciation
    Palenik B, Grimwood J, Aerts A, Rouze P, Salamov A, Putnam N, Dupont C, Jorgensen R, Derelle E and Grigoriev IV <28 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:7705, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer