Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pagma-lipli

Pagrus major lpl mRNA for lipoprotein lipase, complete cds

Comment
2 clones AB054062 AB054062_1 AB054063


Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Pagrus major
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Spariformes: N E > Sparidae: N E > Pagrus: N E > Pagrus major: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB054062
1 Ncbi-nid : 12246843
1 Ncbi-pid : 12246844
2 UniProt : Q98UI2, Q98UI3
2 Interpro : Q98UI2, Q98UI3
2 Pfam : Q98UI2, Q98UI3
2 PIRSF : Q98UI2, Q98UI3
2 SUPERFAM : Q98UI2, Q98UI3
Sequence
Graphical view for this peptide sequence: pagma-lipli
Colored MSA for Lipoprotein_Lipase (raw)
MKAWRVVFLYFLVLNAVVQHVTSLEEELSDSIFGNFLDPLKDLIEHKDDA
NQTVAKFSLRKPSHPDDDLCYIVPGKPDSLAACTFNSSSKTFLVIHGWTL
SGMFESWVAKLVSALYEREQTANVIVVDWLTSAQNHYVVAAQNTKAVGQE
IARFIDWIEETTNMPLENIHLIGYSLGAHVAGFAGSHATNKVGRITGLDP
AGPDFEGMHAHRRLSPDDAHFVDVLHTFTRGSLGLSIGIQQPVGHVDIYP
NGGSFQPGCNLRGALEKIANFGIFAITDAVKCEHERSIHLFIDSLLNEQE
AAKAYRCGSSDMFNRGMCLSCRKGRCNTVGYDISKVRKARNVQMYTKTRA
SMPFRVYHYQLKIHFSSKVNRSEMEPSLTVSLYGTNGEAENLELKLKEKI
ATNKTHSFLLVTEKDIGDLLMLKFKWEETNGWSTSNMLKMVSSWWSGDSD
GANMEVHKIRIRAGETQQKMVFCVKDPESQKLTQEVTFVKCKDAWRTNSK
QTPKRVTLEKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKAWRVVFLYFLVLNAVVQHVTSLEEELSDSIFGNFLDPLKDLIEHKDDA
NQTVAKFSLRKPSHPDDDLCYIVPGKPDSLAACTFNSSSKTFLVIHGWTL
SGMFESWVAKLVSALYEREQTANVIVVDWLTSAQNHYVVAAQNTKAVGQE
IARFIDWIEETTNMPLENIHLIGYSLGAHVAGFAGSHATNKVGRITGLDP
AGPDFEGMHAHRRLSPDDAHFVDVLHTFTRGSLGLSIGIQQPVGHVDIYP
NGGSFQPGCNLRGALEKIANFGIFAITDAVKCEHERSIHLFIDSLLNEQE
AAKAYRCGSSDMFNRGMCLSCRKGRCNTVGYDISKVRKARNVQMYTKTRA
SMPFRVYHYQLKIHFSSKVNRSEMEPSLTVSLYGTNGEAENLELKLKEKI
ATNKTHSFLLVTEKDIGDLLMLKFKWEETNGWSTSNMLKMVSSWWSGDSD
GANMEVHKIRIRAGETQQKMVFCVKDPESQKLTQEVTFVKCKDAWRTNSK
QTPKRVTLEKH


Reference
    Title: Organization of the lipoprotein lipase gene of red sea bream Pagrus major
    Oku H, Ogata HY, Liang XF
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, 131:775, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer