Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: papha-a7ld44

Papio hamadryas (Hamadryas baboon). Endothelial lipase

Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Papio hamadryas
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Papio: N E > Papio hamadryas: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU006877
1 UniProt : A7LD44
1 UniProt : A7LD44
1 Interpro : A7LD44
1 Prodom : A7LD44
1 Pfam : A7LD44
1 PIRSF : A7LD44
1 SUPERFAM : A7LD44
Sequence
Graphical view for this peptide sequence: papha-a7ld44
Colored MSA for Lipoprotein_Lipase (raw)
MSNSVPLLCFWSLCCCFAAGSPTPFGPEGQLEDELHKPKAIQTEVKPSVR
FNLRTSKDPEHEGCYLSLGHSQPLEDCGFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLENVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSMAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKELRSYLSQPHNPGRELNIRRIR
VKSGETQRKLTFCAEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNSVPLLCFWSLCCCFAAGSPTPFGPEGQLEDELHKPKAIQTEVKPSVR
FNLRTSKDPEHEGCYLSLGHSQPLEDCGFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLENVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSMAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKELRSYLSQPHNPGRELNIRRIR
VKSGETQRKLTFCAEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP


Reference
    Title: Identification of promoter variants in baboon endothelial lipase that regulate high-density lipoprotein cholesterol levels
    Cox LA, Birnbaum S, Mahaney MC, Rainwater DL, Williams JT, Vandeberg JL
    Ref: Circulation, 116:1185, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer