Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pardp-a1b9s7

Paracoccus denitrificans (strain Pd 1222) Poly-beta-hydroxybutyrate polymerase domain protein

Relationship
Family|PhaC_cen_dom
Block| X
Position in NCBI Life Tree|Paracoccus denitrificans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Paracoccus: N E > Paracoccus denitrificans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000490
1 UniProt : A1B9S7
1 UniProt : A1B9S7
1 Interpro : A1B9S7
1 Pfam : A1B9S7
1 PIRSF : A1B9S7
1 SUPERFAM : A1B9S7
Sequence
Graphical view for this peptide sequence: pardp-a1b9s7
Colored MSA for PhaC_cen_dom (raw)
MTHKVNTPEAGPAGTDTAPYRTIDRLREAMAAGFGTGVSPLALGMALIDW
SAHLAAAPGKRLELADRAARETAELMAHIAALATDPKAEPVIRPGPQDRR
FAAAAWQNPPFSIWVQGFLLARQWWHEATHDVPGTDPHYENLLSAMVRQW
LDMASPANLPFTNPEIIARSMQTAGLNHLAGMRNWCEDMARLAAGKPPVG
TERFRVGYEVAATPGKVVFRNHLIELIQYAPATETVLAEPVLLIPAWIMK
YYILDLSPENSLVRHLVQAGHTVFCLSWRNPTADDRDLTLDDYRRLGVMA
AVEAINAILPGRGIHAAGYCLGGTLLAIAAAAMAGARDDRLASVSLLAAQ
TDFTEPGDLALFVDHDQLHSLENAMRQRGYLTAEQMLGAFRFLRSNDLVW
SRMVHAYLMGEREPMTDILAWSSDSTRMPYRMQDEYLRRLYLENALAGDR
LRADGRPVALRNLRAPIFAVGTEEDYVAPWRSVYQLHCLSDAELTFVLAD
KDHLAGIIFDPSQPGSHYRIATRGPDDTCLPPEDWLRAAAWREGSWWPAW
SGWLARHSAAERVAPPGIGAAAAGYPALEDAPGSYVRQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTHKVNTPEAGPAGTDTAPYRTIDRLREAMAAGFGTGVSPLALGMALIDW
SAHLAAAPGKRLELADRAARETAELMAHIAALATDPKAEPVIRPGPQDRR
FAAAAWQNPPFSIWVQGFLLARQWWHEATHDVPGTDPHYENLLSAMVRQW
LDMASPANLPFTNPEIIARSMQTAGLNHLAGMRNWCEDMARLAAGKPPVG
TERFRVGYEVAATPGKVVFRNHLIELIQYAPATETVLAEPVLLIPAWIMK
YYILDLSPENSLVRHLVQAGHTVFCLSWRNPTADDRDLTLDDYRRLGVMA
AVEAINAILPGRGIHAAGYCLGGTLLAIAAAAMAGARDDRLASVSLLAAQ
TDFTEPGDLALFVDHDQLHSLENAMRQRGYLTAEQMLGAFRFLRSNDLVW
SRMVHAYLMGEREPMTDILAWSSDSTRMPYRMQDEYLRRLYLENALAGDR
LRADGRPVALRNLRAPIFAVGTEEDYVAPWRSVYQLHCLSDAELTFVLAD
KDHLAGIIFDPSQPGSHYRIATRGPDDTCLPPEDWLRAAAWREGSWWPAW
SGWLARHSAAERVAPPGIGAAAAGYPALEDAPGSYVRQR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer