Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pea-KAI2C

Pisum sativum (Garden pea) Strigolactone esterase, KAI2C Psat3g014200 PsKAI2C

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Pisum sativum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Fabeae: N E > Pisum: N E > Pisum sativum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: pea-KAI2C
Colored MSA for RsbQ-like (raw)
MGIMKAHNVNVLGRRNRFIVLANGFSTNQSMWKYFVPHLVDDFRVVLYDN
MCAGTTNPDYFGFQCHSILEGHAYDLLIILEELRVDSCIFISHSFLAMIG
AITSISRPDLFLNMIMNDMRQQLKLVTVPCHIIQVEKDMAFLVMVSEFPH
QQLGGESIVEVMATDGHLTLLSFPNTVISVWFKHIQLDIAPVR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGIMKAHNVNVLGRRNRFIVLANGFSTNQSMWKYFVPHLVDDFRVVLYDN
MCAGTTNPDYFGFQCHSILEGHAYDLLIILEELRVDSCIFISHSFLAMIG
AITSISRPDLFLNMIMNDMRQQLKLVTVPCHIIQVEKDMAFLVMVSEFPH
QQLGGESIVEVMATDGHLTLLSFPNTVISVWFKHIQLDIAPVR


Reference
    Title: Structural and functional analyses explain Pea KAI2 receptor diversity and reveal stereoselective catalysis during signal perception
    Guercio AM, Torabi S, Cornu D, Dalmais M, Bendahmane A, Le Signor C, Pillot JP, Le Bris P, Boyer FD and Shabek N <3 more author(s)>
    Ref: Commun Biol, 5:126, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer