Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pedhc-ACHE2

Pediculus humanus capitis (human head louse) Ace1 acetylcholinesterase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Pediculus humanus capitis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Psocodea: N E > Phthiraptera: N E > Anoplura: N E > Pediculidae: N E > Pediculus: N E > Pediculus humanus: N E > Pediculus humanus capitis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB266614
1 UniProt : A2PZ98
1 Ncbi-nid : 124377671
1 Ncbi-pid : 124377672
1 UniProt : A2PZ98
1 Interpro : A2PZ98
1 Prodom : A2PZ98
1 Pfam : A2PZ98
1 PIRSF : A2PZ98
1 SUPERFAM : A2PZ98
Sequence
Graphical view for this peptide sequence: pedhc-ACHE2
Colored MSA for ACHE (raw)
MKNINMIKTNSIIMILTVVGHILGTPWSINSLSLINTTASRDYHTDPLIV
ETTSGLVKGFSKTILGREVYVYLGIPFAKPPVGPLRFRRPMPIDPWHGVY
EAVTPPNSCFQERYEYFPGFEGEEMWNPNTNISEDCLYLNVWVPQKVRLR
HGGSQEENYAKKAMLVWIYGGGFMSGTSTLDVYDADIVAASSDVIVASMQ
YRVGAFGFFYLAPYFDSESEEGQGNMGLWDQALAIRWLKDNAKVFGGDPD
LITLFGESAGGGSVSLHLMSPVTRGIVKRGILQSGTLNAPWSYMEADKAV
EIAKTLIDDCGCNSSSLIDHADSVMECMRIIDAKQISVQQWNSYWGILGF
PSAPTIDGIFLPEHPIDMMKKGDFPETELLVGSNQDEGTYFLLYDFIDYF
EKDGPSYLDRDKFLELIDNIFKNVTKAEKEAIIFQYTDWDQVNDGLVNQK
MISDIVGDYYFICPTNYFAQLMAERGTKVYYYFFSQRTSTNVWGEWMGVM
HGDEIEYVFGNPLNMSIQFNNKERNLSKRMMEAFARFALTGKPMPDEVEW
PLYTKEQPQYYIFNAEKTGIGRGPRSTACQFWNGFLPKIKSGRHLMRPMN
TLSCPTQTANEILADLSAGGYKSHKSLSLGVITLVVVLLIKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNINMIKTNSIIMILTVVGHILGTPWSINSLSLINTTASRDYHTDPLIV
ETTSGLVKGFSKTILGREVYVYLGIPFAKPPVGPLRFRRPMPIDPWHGVY
EAVTPPNSCFQERYEYFPGFEGEEMWNPNTNISEDCLYLNVWVPQKVRLR
HGGSQEENYAKKAMLVWIYGGGFMSGTSTLDVYDADIVAASSDVIVASMQ
YRVGAFGFFYLAPYFDSESEEGQGNMGLWDQALAIRWLKDNAKVFGGDPD
LITLFGESAGGGSVSLHLMSPVTRGIVKRGILQSGTLNAPWSYMEADKAV
EIAKTLIDDCGCNSSSLIDHADSVMECMRIIDAKQISVQQWNSYWGILGF
PSAPTIDGIFLPEHPIDMMKKGDFPETELLVGSNQDEGTYFLLYDFIDYF
EKDGPSYLDRDKFLELIDNIFKNVTKAEKEAIIFQYTDWDQVNDGLVNQK
MISDIVGDYYFICPTNYFAQLMAERGTKVYYYFFSQRTSTNVWGEWMGVM
HGDEIEYVFGNPLNMSIQFNNKERNLSKRMMEAFARFALTGKPMPDEVEW
PLYTKEQPQYYIFNAEKTGIGRGPRSTACQFWNGFLPKIKSGRHLMRPMN
TLSCPTQTANEILADLSAGGYKSHKSLSLGVITLVVVLLIKL


Reference
    Title: Molecular characterization of two acetylcholinesterase cDNAs in Pediculus human lice
    Lee SW, Kasai S, Komagata O, Kobayashi M, Agui N, Kono Y, Tomita T
    Ref: Journal of Medical Entomology, 44:72, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer