Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pelts-a5d5p1

Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) Homoserine acetyltransferase

Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Pelotomaculum thermopropionicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Peptococcaceae: N E > Pelotomaculum: N E > Pelotomaculum thermopropionicum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP009389
1 UniProt : A5D5P1
1 UniProt : A5D5P1
1 Interpro : A5D5P1
1 Prodom : A5D5P1
1 Pfam : A5D5P1
1 PIRSF : A5D5P1
1 SUPERFAM : A5D5P1
Sequence
Graphical view for this peptide sequence: pelts-a5d5p1
Colored MSA for Homoserine_transacetylase (raw)
MRPSFKAVRRGGLEMSDPLNVLTKKTPRQFDQAGSPRSVGWTRAHRVRLA
DEKNPLPLDCGKTIAPVDVEYEIYGKLNRARDNAILICHALSGDAHAAGW
SADAGRLGRPWLKNRPGWWDVMIGPGKAFDTDKYCVICSNILGSCYGTTG
PSSIDPETGRPYGLRFPVVTVGDWVRLQERLISHLGIDRLLAVAGGSLGG
QQALEWALAYPDRVESAIIIASAARLSDQGLAFNVVARNAIMTDPNFKDG
DYYGGPTPGRGLEVARMLGHITYLSETSMENKFGRRFCNGEGPGFHLGVD
FEVEGYLRHQGKAFVERFDANSYLYITRAMDYYDASAWGEGDLDKACRRI
ESRLLLVSFSSDWLYSPAHTKELALALGRARKRVSYANIESSYGHDAFLL
EVEKLSHLVRCFLGEGVAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPSFKAVRRGGLEMSDPLNVLTKKTPRQFDQAGSPRSVGWTRAHRVRLA
DEKNPLPLDCGKTIAPVDVEYEIYGKLNRARDNAILICHALSGDAHAAGW
SADAGRLGRPWLKNRPGWWDVMIGPGKAFDTDKYCVICSNILGSCYGTTG
PSSIDPETGRPYGLRFPVVTVGDWVRLQERLISHLGIDRLLAVAGGSLGG
QQALEWALAYPDRVESAIIIASAARLSDQGLAFNVVARNAIMTDPNFKDG
DYYGGPTPGRGLEVARMLGHITYLSETSMENKFGRRFCNGEGPGFHLGVD
FEVEGYLRHQGKAFVERFDANSYLYITRAMDYYDASAWGEGDLDKACRRI
ESRLLLVSFSSDWLYSPAHTKELALALGRARKRVSYANIESSYGHDAFLL
EVEKLSHLVRCFLGEGVAE


Reference
    Title: The genome of Pelotomaculum thermopropionicum reveals niche-associated evolution in anaerobic microbiota
    Kosaka T, Kato S, Shimoyama T, Ishii S, Abe T, Watanabe K
    Ref: Genome Res, 18:442, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer