Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penfu-PHAZ

Penicillium funiculosum Polyhydroxybutyrate Depolymerase

Comment
Hisano, T., Kasuya, K., Saito, T., Iwata, T., Miki, K This is a circularly permuted variant of the alpha/beta hydrolase fold. Other strains: Talaromyces funiculosus (Fruitlet core rot fungus) (Penicillium funiculosum); Penicillium sp. 'occitanis'


Relationship
Family|Esterase_phb_PHAZ
Block| X
Position in NCBI Life Tree|Penicillium funiculosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces funiculosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2D80, 2D81
No kinetic





1 substrate:
RB3
No inhibitor
2 Genbank : PCH00240, BAG32152
2 UniProt : B2NHN2, A0A2H3IWT3
2 Structure : 2D80, 2D81
2 UniProt : B2NHN2, A0A2H3IWT3
2 Interpro : B2NHN2, A0A2H3IWT3
2 Pfam : B2NHN2, A0A2H3IWT3
2 PIRSF : B2NHN2, A0A2H3IWT3
2 SUPERFAM : B2NHN2, A0A2H3IWT3
Sequence
Graphical view for this peptide sequence: penfu-PHAZ
Colored MSA for Esterase_phb_PHAZ (raw)
MFDSVKIAWLVALGAAQVAATALPAFNVNPNSVSVSGLSSGGYMAAQLGV
AYSDVFNVGFGVFAGGPYDCARNQYYTSCMYNGYPSITTPTANMKSWSGN
QIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGNFDNSANVSYVTT
TGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGAALKWIYGSLNARN
TGTLSGSVLSFAQGSYGANGMDTTGYLYVPQSCASGATVCSLHVALHGCL
QSYSSIGSRFIQNTGYNKWADTNNMIILYPQAIPDYTSIHAIWNGGVLSN
PNGCWDWVGWYGSNADQIGGVQMAAIVGQVKQIVSGFQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFDSVKIAWLVALGAAQVAATALPAFNVNPNSVSVSGLSSGGYMAAQLGV
AYSDVFNVGFGVFAGGPYDCARNQYYTSCMYNGYPSITTPTANMKSWSGN
QIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGNFDNSANVSYVTT
TGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGAALKWIYGSLNARN
TGTLSGSVLSFAQGSYGANGMDTTGYLYVPQSCASGATVCSLHVALHGCL
QSYSSIGSRFIQNTGYNKWADTNNMIILYPQAIPDYTSIHAIWNGGVLSN
PNGCWDWVGWYGSNADQIGGVQMAAIVGQVKQIVSGFQG


References
    Title: The crystal structure of polyhydroxybutyrate depolymerase from Penicillium funiculosum provides insights into the recognition and degradation of biopolyesters
    Hisano T, Kasuya K, Tezuka Y, Ishii N, Kobayashi T, Shiraki M, Oroudjev E, Hansma H, Iwata T and Miki K <2 more author(s)>
    Ref: Journal of Molecular Biology, 356:993, 2006 : PubMed

            

    Title: Properties of a Poly(3-hydroxybutyrate) Depolymerase from Penicillium funiculosum
    Miyazaki S, Takahashi K, Shiraki M, Saito T, Tezuka Y, Kasuya KI
    Ref: J. Polym. Environ, 8:175, 2000 : PubMed

            

    Title: Extracellular poly(3-hydroxybutyrate) depolymerase from Penicillium funiculosum: general characteristics and active site studies
    Brucato CL, Wong SS
    Ref: Archives of Biochemistry & Biophysics, 290:497, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer